We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Daxx Antibody - BSA Free

Images

 
Genetic Strategies: Western Blot: Daxx Antibody [NBP1-85309] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-DAXX antibody. Remaining relative ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Daxx Antibody [NBP1-85309] - Staining in human testis and skeletal muscle tissues . Corresponding DAXX RNA-seq data are presented for the same tissues.
Western Blot: Daxx Antibody [NBP1-85309] - Analysis in control (vector only transfected HEK293T lysate) and DAXX over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Daxx Antibody [NBP1-85309] - Staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: Daxx Antibody [NBP1-85309] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Daxx Antibody [NBP1-85309] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts and in Leydig cells.
Immunohistochemistry-Paraffin: Daxx Antibody [NBP1-85309] - Staining of human tonsil shows moderate to strong nuclear positivity in lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

Daxx Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DAXX
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Daxx Protein (NBP1-85309PEP)
Publications
Read Publications using
NBP1-85309 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Daxx Antibody - BSA Free

  • BING2
  • CENP-C binding protein
  • DAP6
  • DAP6MGC126245
  • Daxx
  • death domain-associated protein 6
  • death-associated protein 6
  • death-domain associated protein
  • EAP1
  • ETS1-associated protein 1
  • Fas death domain-associated protein
  • Fas-binding protein
  • hDaxx
  • MGC126246

Background

Daxx (death-domain-associated protein) was originally identified as a cytoplasmic protein that binds to the death domain of the transmembrane death receptor Fas. It is now that known that the a large porportion of Daxx molecules are nuclear and associate with the promyelocytic leukaemia nuclear body (PML-NB) and other subnuclear domains (reviewed in Salomoni and Khelifi). The promyelocytic leukemia protein Pml is an essential component of the PML-NB. Data suggests that certain stimuli including Fas stimulation, causes Daxx to be translocated from the nucleus to the cytoplasm. Daxx is ubiquitously expressed, and particularly high levels of Daxx have been reported in the thymus and testes. At the cellular level Daxx may be found in cytoplasm and within heterochromatic regions of the nucleus. Daxx has been reported to interact and co-localize with Pml in the nucleus of tumor cell lines and primary cells. Pml is necessary for Fas-induced cell death and Daxx pro-apoptotic functions. Daxx is thought to have both pro- and anti-apoptotic functions depending on the stimulus and the cell type. Daxx pro-apoptotic functions appear to occur in both the cytoplasm and nucleus. Although the mechanisms remain to be fully elucidated, research indicates that Daxx plays a role in the pathology of human diseases including cancer and neurodegerative disorders. Human Daxx is a 740 amino acid protein (GenBank no. gi/62898369).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-59787
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, PLA, WB
NBP2-37592
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB120-13550
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-86060
Species: Hu
Applications: IHC,  IHC-P, Micro, WB
NBP3-15951
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-83077
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-47839
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-92897
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NBP2-32972
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF1230
Applications: IHC, KO, WB
NBP1-85309
Species: Hu
Applications: WB, IHC

Publications for Daxx Antibody (NBP1-85309)(9)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IF/IHC, WB.


Filter By Application
IF/IHC
(3)
WB
(1)
All Applications
Filter By Species
Human
(4)
All Species
Showing Publications 1 - 9 of 9.
Publications using NBP1-85309 Applications Species
Robert Siddaway, Scott Milos, Étienne Coyaud, Hwa Young Yun, Shahir M. Morcos, Sanja Pajovic, Eric I. Campos, Brian Raught, Cynthia Hawkins The in v ivo Interaction Landscape of Histones H3.1 and H3.3 Molecular & Cellular Proteomics : MCP 2022-09-09 [PMID: 36089195]
Masayuki Yoshida, Reiko Ogawa, Hiroshi Yoshida et al. TERT promoter mutations are frequent and show association with MED12 mutations in phyllodes tumors of the breast. British Journal of Cancer 2015-09-10 [PMID: 26355235] (IF/IHC, Human) IF/IHC Human
Napier CE, Huschtscha LI, Harvey A et al. ATRX represses alternative lengthening of telomeres. Oncotarget 2015-06-30 [PMID: 26001292] (WB, Human) WB Human
Pipinikas CP, Dibra H, Karpathakis A et al. Epigenetic dysregulation and poorer prognosis in DAXX-deficient pancreatic neuroendocrine tumours. Endocr Relat Cancer 2015-06-01 [PMID: 25900181] (IF/IHC, Human) IF/IHC Human
Fishbein L, Khare S, Wubbenhorst B et al. Whole exome sequencing identifies somatic ATRX mutations in pheochromocytomas and paragangliomas. Nat Commun 2015-01-21 [PMID: 25608029] (IF/IHC, Human) IF/IHC Human
Stepp WH, Meyers JM, McBride AA. Sp100 Provides Intrinsic Immunity against Human Papillomavirus Infection. mBio 2013-11-05 [PMID: 24194542]
de Wilde RF, Heaphy CM, Maitra A et al. Loss of ATRX or DAXX expression and concomitant acquisition of the alternative lengthening of telomeres phenotype are late events in a small subset of MEN-1 syndrome pancreatic neuroendocrine tumors. Mod Pathol 2012-07-01 [PMID: 22575867]
Schwartzentruber J, Korshunov A, Liu XY et al. Driver mutations in histone H3.3 and chromatin remodelling genes in paediatric glioblastoma. Nature 2012-01-29 [PMID: 22286061]
Heaphy CM, de Wilde RF, Jiao Y et al. Altered telomeres in tumors with ATRX and DAXX mutations. Science 2011-07-22 [PMID: 21719641]

Reviews for Daxx Antibody (NBP1-85309) (0)

There are no reviews for Daxx Antibody (NBP1-85309). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Daxx Antibody (NBP1-85309) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Daxx Products

Research Areas for Daxx Antibody (NBP1-85309)

Find related products by research area.

Blogs on Daxx

There are no specific blogs for Daxx, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Daxx Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol DAXX