53BP2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: 53BP2 Antibody [NBP2-58677] - Staining of human cell line U-251 MG shows localization to cytosol & cell junctions.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

53BP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit 53BP2 Antibody - BSA Free (NBP2-58677) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TISVPSYPSKSASVTASSESPVEIQNPYLHVEPEKEVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDNSPNLQNNPEEPNPEAPHVLDVYLE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TP53BP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  53BP2 Recombinant Protein Antigen (NBP2-58677PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for 53BP2 Antibody - BSA Free

• apoptosis-stimulating protein of p53, 2
• ASPP2P53BP2,53BP2apoptosis-stimulating of p53 protein 2
• Bbp
• Bcl2-binding protein
• p53-binding protein 2
• p53BP2
• PPP1R13A
• Renal carcinoma antigen NY-REN-51
• tumor protein p53 binding protein, 2
• tumor protein p53-binding protein, 2
• Tumor suppressor p53-binding protein 2

Background

53BP2 encodes a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. It is localized to the perinuclear region of the cytoplasm, and regulates apoptosis and cell growth through interactions with other regulatory molecules including members of the p53 family. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TP53BP2