Recombinant Human 5'-Nucleotidase/CD73 GST (N-Term) Protein

SDS-Page: Recombinant Human 5'-Nucleotidase/CD73 Protein [H00004907-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human 5'-Nucleotidase/CD73 GST (N-Term) Protein Summary

• Description: Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 28 - 264 of Human NT5E full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: ELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGSEMDKLIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Full Length Recombinant Protein
• Gene: NT5E
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Immunocytochemistry/ Immunofluorescence
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 51.81 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 5'-Nucleotidase/CD73 GST (N-Term) Protein

• 5' nucleotidase (CD73)
• 5'-NT
• 5-NT
• 5'-Nucleotidase
• 5'-nucleotidase, ecto (CD73)
• CD73 antigen
• CD73
• E5NT
• EC 3.1.3.5
• ecto-5'-nucleotidase
• eN
• eNT
• NT
• NT55'-nucleotidase
• NT5E
• NTE
• Purine 5-Prime-Nucleotidase

Background

NT5E( AAH15940, 28 a.a. - 265 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01)(1)

Publication using H00004907-P01

• Esteban-Vives R, Ziembicki J, Choi MS et al. Isolation and Characterization of a Human Fetal Mesenchymal Stem Cell Population: Exploring the Potential for Cell Banking in Wound Healing Therapies Cell Transplant 2019-08-13 [PMID: 31407589] (ICC/IF, Human)

FAQs for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01). (Showing 1 - 1 of 1 FAQ).

1. We are interested in CD73 antibodies that could react with dog, please let me know which products in your catalog you would recommend.
   • We do not currently carry any CD73 antibodies that have been validated for use in dog samples. However, if you are interested in testing any of our CD73 antibodies with dog samples you would be eligible for our Innovators Reward Program, in which you can get a discount voucher for the purchase price of the product. Please contact us at innovators@novusbio.com with any questions regarding this program.

Bioinformatics

• Gene Symbol: NT5E