Home » 5'-Nucleotidase/CD73 » 5'-Nucleotidase/CD73 Proteins » Recombinant Human 5'-Nucleotidase/CD73 GST (N-Term) Protein

Recombinant Human 5'-Nucleotidase/CD73 GST (N-Term) Protein

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human 5'-Nucleotidase/CD73 Protein [H00004907-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human 5'-Nucleotidase/CD73 Protein [H00004907-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, PA, PAGE, AP

Order Details

100% Guarantee on every product

Recombinant Human 5'-Nucleotidase/CD73 GST (N-Term) Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 28 - 264 of Human NT5E full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: ELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGSEMDKLIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
NT5E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
51.81 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
H00004907-P01 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 5'-Nucleotidase/CD73 GST (N-Term) Protein

  • 5' nucleotidase (CD73)
  • 5'-NT
  • 5-NT
  • 5'-Nucleotidase
  • 5'-nucleotidase, ecto (CD73)
  • CD73 antigen
  • CD73
  • E5NT
  • EC 3.1.3.5
  • ecto-5'-nucleotidase
  • eN
  • eNT
  • NT
  • NT55'-nucleotidase
  • NT5E
  • NTE
  • Purine 5-Prime-Nucleotidase

Background

NT5E( AAH15940, 28 a.a. - 265 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Neurotensin
Antibody
NBP2-33903
Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Analysis in human small intestine and skeletal muscle tissues. Corresponding NTS RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Species: Hu
Applications: IHC, IHC-P
Adenosine
Deaminase/ADA Antibod
NBP1-87404
Western Blot: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Analysis in human duodenum and testis tissues using NBP1-87404 antibody. Corresponding Adenosine Deaminase/ADA RNA-seq data are presented for the same tissues.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
Endoglin/CD105
[HRP]
DNDG00
(30 Publications)
Species: Hu
HLA DQ Antibody
(SPV-L3)
NBP2-45041
Flow Cytometry: HLA DQ Antibody (SPV-L3) [NBP2-45041] - Flow Cytometric Analysis of Raji cells. HLA DQ Antibody (SPV-L3) followed by goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
(1 Publication)
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
BDNF [HRP]
DBD00
(4 Reviews)
(53 Publications)
Species: Hu
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - HCMV infection induces NOD2 mRNA and protein in HFFs and U373 cells. E. U373 glioma cells were infected with HCMV Towne strain and levels of NOD1, NOD2 and GAPDH mRNAs were measured by qRT-PCR at indicated time points. F. HFFs were infected with HCMV (Towne) at MOI of 1 PFU/cell and levels of NOD2 protein and B-actin were determined 48 and 72 hpi. G. HFFs were infected with HCMV (Towne) strain at MOI of 0.03 or 3 PFU/cell and levels of NOD2 protein and B-actin were determined at 48 hpi. Quantitative data represent mean values (+/-SD) of triplicate determinations from three independent experiments (*p<0.05, **p<0.01, ***p<0.001, one-way ANOVA test). Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092704.g001) licensed under a CC-BY licence.
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(20 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC

Acetylcholinesterase/A
NB100-1519
Western Blot: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Staining of HepG2 (A) and Daudi cell lysates with antibody at 1 ug/mL (B) and HeLa (C) and Jurkat (D) cell lysates with antibody at 0.3 ug/mL (35 ug protein in RIPA buffer). Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Immunofluorescence analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (4 ug/mL), showing cytoplasmic and nuclear/Vesicle staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (4 ug/mL).
Flow Cytometry: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Flow cytometric analysis of paraformaldehyde fixed HeLa cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, IHC-FrFl
CD90/Thy1 Antibody
(OX-7)
NB100-65543
Flow Cytometry: CD90/Thy1 Antibody (OX-7) [NB100-65543] - Staining of rat thymus.
Flow Cytometry: CD90/Thy1 Antibody (OX-7) [NB100-65543] - Staining of rat thymus with MOUSE ANTI RAT CD90 (THY 1.1).
Flow Cytometry: CD90/Thy1 Antibody (OX-7) [NB100-65543] - Staining of rat thymocytes.
(11 Publications)
Species: Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
CD45 Antibody
(30-F11)
NB100-77417
Flow Cytometry: CD45 Antibody (30-F11) [NB100-77417] - Analysis of CD45 (30F11) in freshly isolated mouse (Balb C) splenocytes (1x10^6) were stained with [NB100-77417] at 1:1000 dilution and detected with FITC conjugated donkey anti-rat IgG secondary (orange). Shown with rat IgG isotype control (blue).
Immunohistochemistry-Paraffin: CD45 Antibody (30-F11) [NB100-77417] - Analysis of FFPE section of mouse spleen using rat monoclonal CD45 antibody (30-F11) [NB100-77417] at 1:50 dilution. The antibody generated an expected membrane staining in the red and white pulp spleenocytes of the tested spleen section.
Immunohistochemistry-Paraffin: CD45 Antibody (30-F11) [NB100-77417] - Staining of a FFPE mouse liver tissue section using 1:100 dilution of CD45 antibody (30-F11) [NB100-77417]. Signal was detected using AF488 conjugated donkey anti-rat secondary antibody at 1:500 dilution. Image submitted via verified customer review.
(4 Reviews)
(25 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
PNPLA6 Antibody
(3D10)
H00010908-M08
Western Blot: PNPLA6 Antibody (3D10) [H00010908-M08] - Analysis of PNPLA6 expression in transfected 293T cell line by NTE monoclonal antibody (M08), clone 3D10. Lane 1: PNPLA6 transfected lysate (Predicted MW: 146.2 KDa). Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: PNPLA6 Antibody (3D10) [H00010908-M08] - Analysis of monoclonal antibody to PNPLA6 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml
Sandwich ELISA: PNPLA6 Antibody (3D10) [H00010908-M08] - Detection limit for recombinant GST tagged PNPLA6 is 1 ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
CD34 Antibody (MEC
14.7)
NB600-1071
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry-Paraffin: CD34 Antibody (MEC 14.7) [NB600-1071] - Analysis of a FFPE tissue section of mouse small intestine using rat anti-mouse CD34 (clone MEC 14.7) at 1:100 dilution. The signal was developed using HRP-conjugated anti-rat secondary with DAB reagent which followed counterstaining of nuclei using hematoxylin. This antibody specifically labelled the endothelial cells in blood vessels located primarily in the sub-mucosa, and of that of the mucosa muscularis and the mucosal lacteal.
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - An intracellular stain was performed on Raw264.7 cells with CD34 Antibody [MEC 14.7] NB600-1071 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rat IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 488 (SA5-10018, Thermo Fisher).
(20 Publications)
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
CD39/ENTPD1
Antibody
NBP1-90071
Western Blot: CD39/ENTPD1 Antibody [NBP1-90071] - Analysis in human cell line HDLM-2.
Immunocytochemistry/Immunofluorescence: CD39/ENTPD1 Antibody [NBP1-90071] - Staining of human aortic valve endothelial calls. Image from verified customer review.
Immunohistochemistry-Paraffin: CD39/ENTPD1 Antibody [NBP1-90071] - Staining in human placenta and skeletal muscle tissues using NBP1-90071 antibody. Corresponding ENTPD1 RNA-seq data are presented for the same tissues.
(3 Reviews)
(4 Publications)
Species: Hu, Mu, Po, Eq
Applications: WB, Flow, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(645 Publications)
Species: Hu
Substance P
Antibody
NB300-187
Immunocytochemistry/Immunofluorescence: Substance P Antibody [NB300-187] - Staining of trigeminal ganglia from P3-P5 rat pups. BMC Neuroscience 2010, 11:32doi:10.1186/1471-2202-11-32
Immunohistochemistry: Substance P Antibody [NB300-187] - Spinal Cord Dorsal Horn (Human).
Immunocytochemistry/Immunofluorescence: Substance P Antibody [NB300-187] - Detection of Substance P in rat spinal cord dorsal horn (red fluorescence). DAPI (blue) was used as counter stain.
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NT-3 [Unconjugated]
267-N3/CF
1 μg/lane of Recombinant Human NT-3 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human NT-3 (Catalog #267‑N3/CF) stimulates cell proliferation in the BaF mouse pro-B cell line transfected with TrkB. The ED50 for this effect is 1-10 ng/mL.
(44 Publications)
Species: Hu
ADK Antibody
NBP2-15291
Western Blot: ADK Antibody [NBP2-15291] - Mouse tissue extracts (50 ug) was separated by 10 % SDS-PAGE, and the membrane was blotted with Adenosine kinase antibody diluted by 1:1500.
Immunocytochemistry/Immunofluorescence: ADK Antibody [NBP2-15291] - Paraformaldehyde-fixed A431, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: ADK Antibody [NBP2-15291] - Paraffin-embedded mouse kidney. Adenosine kinase antibody dilution: 1:500.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
CD44 Antibody
(8E2F3)
NBP1-47386
Immunocytochemistry/Immunofluorescence: CD44 Antibody (8E2F3) [NBP1-47386] - Analysis of paraffin-embedded human lung cancer tissues using anti-CD44 mAb (green), showing membrane localization. DRAQ5 fluorescent DNA dye (blue).
Immunohistochemistry-Paraffin: CD44 Antibody (8E2F3) [NBP1-47386] - Analysis of FFPE human breast carcinoma tissues using CD44 antibody (8E2F3). The signal was developed using DAB based detection and the sections were processed for counterstaining with hematoxylin. The antibody generated mainly a membrane staining representative of CD44 protein.
Flow Cytometry: CD44 Antibody (8E2F3) [NBP1-47386] - Analysis of HeLa cells using anti-CD44 mAb (right) and negative control (left).
(1 Review)
(13 Publications)
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01) (0)

There are no reviews for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01). (Showing 1 - 1 of 1 FAQ).

  1. We are interested in CD73 antibodies that could react with dog, please let me know which products in your catalog you would recommend.
    • We do not currently carry any CD73 antibodies that have been validated for use in dog samples. However, if you are interested in testing any of our CD73 antibodies with dog samples you would be eligible for our Innovators Reward Program, in which you can get a discount voucher for the purchase price of the product. Please contact us at innovators@novusbio.com with any questions regarding this program.

Other Available Formats

Learn about Custom Antibody Labeling

Additional 5'-Nucleotidase/CD73 Products

Bioinformatics Tool for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01)

Discover related pathways, diseases and genes to 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01)

Discover more about diseases related to 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01).
 

Pathways for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01)

View related products by pathway.

PTMs for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01)

Learn more about PTMs related to 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01).
 

Research Areas for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01)

Find related products by research area.

Blogs on 5'-Nucleotidase/CD73.

Check out the latest blog posts on 5'-Nucleotidase/CD73.
Adenosine Inhibits T cell Tumor Infiltration: KCa3.1, a New Anticancer Target
By Yoskaly Lazo-Fernandez, PhD Role of Adenosine in the Tumor Microenvironment a Target for Cancer TherapyThe tumor microenvironment (TME) tends to be concentrated in the purine nucleoside adenosine, a direct resu...  Read full blog post.
CD73 (Cluster of differentiation 73, ecto-5'-nucleotidase)
CD73 is a 70kD glycosyl-phosphatidylinositol (GPI)-anchored cell surface molecule that belongs to the 5'-nucleosidase family. It hydrolyzes extracellular nucleotides into membrane permeable nucleosides and is found as both a membrane-bound and soluble...  Read full blog post.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Western Blot: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Analysis in human cell line U-87 MG.
5'-Nucleotidase/CD73 Antibody
NBP1-85740
BDNF [HRP]
BDNF [HRP]
DBD00

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human 5'-Nucleotidase/CD73 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol NT5E