Recombinant Human 5'-Nucleotidase/CD73 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human 5'-Nucleotidase/CD73 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 28 - 264 of Human NT5E full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGSEMDKLIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
NT5E

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 5'-Nucleotidase/CD73 Protein

  • 5' nucleotidase (CD73)
  • 5'-NT
  • 5-NT
  • 5'Nucleotidase
  • 5'-Nucleotidase
  • 5'-nucleotidase, ecto (CD73)
  • CD73 antigen
  • CD73
  • E5NT
  • EC 3.1.3.5
  • ecto-5'-nucleotidase
  • eN
  • eNT
  • NT
  • NT55'-nucleotidase
  • NT5E
  • NTE
  • Purine 5-Prime-Nucleotidase

Background

NT5E( AAH15940, 28 a.a. - 265 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
H00010908-M08
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-90071
Species: Hu, Mu, Po, Eq
Applications: WB, ICC/IF, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01) (0)

There are no publications for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01) (0)

There are no reviews for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01). (Showing 1 - 1 of 1 FAQ).

  1. We are interested in CD73 antibodies that could react with dog, please let me know which products in your catalog you would recommend.
    • We do not currently carry any CD73 antibodies that have been validated for use in dog samples. However, if you are interested in testing any of our CD73 antibodies with dog samples you would be eligible for our Innovators Reward Program, in which you can get a discount voucher for the purchase price of the product. Please contact us at innovators@novusbio.com with any questions regarding this program.

Additional 5'-Nucleotidase/CD73 Products

Bioinformatics Tool for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01)

Discover related pathways, diseases and genes to 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01)

Discover more about diseases related to 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01).
 

Pathways for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01)

View related products by pathway.

PTMs for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01)

Learn more about PTMs related to 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01).
 

Research Areas for 5'-Nucleotidase/CD73 Recombinant Protein (H00004907-P01)

Find related products by research area.

Blogs on 5'-Nucleotidase/CD73.

CD73 (Cluster of differentiation 73, ecto-5'-nucleotidase)
CD73 is a 70kD glycosyl-phosphatidylinositol (GPI)-anchored cell surface molecule that belongs to the 5'-nucleosidase family. It hydrolyzes extracellular nucleotides into membrane permeable nucleosides and is found as both a membrane-bound and soluble...  Read full blog post.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human 5'-Nucleotidase/CD73 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NT5E
Entrez