5-HT1D Antibody - Azide and BSA Free Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 150-250 of human HTR1D (NP_000855.1). RTAGHAATMIAIVWAISICISIPPLFWRQAKAQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HTR1D |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL.
- Western Blot 1:500-1:2000
|
| Theoretical MW |
42 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for 5-HT1D Antibody - Azide and BSA Free
Background
Serotonin (5-hydroxytryptamine, 5-HT), originally discovered as a serum factor plays important roles in regulating diverse biological processes in central and peripheral nervous systems, cardiovascular systems, and gastrointestinal systems (1,2). The 5-HT1D (formerly known as 5-HT1Da) receptor has 63% overall structural homology with the 5-HT1B receptor and a 77% amino acid sequence homology in the seven transmembrane domains (3). In situ hybridization studies have detected highest level of mRNA in primary olfactory cortex, accumbens nucleus, caudate putamen, lateral mammilary nucleus and medial vestibular nucleus (4). The presence of relatively high levels of 5-HT1D mRNA in the locus coeruleus suggest that, when expressed on nerve terminals, this receptor could modulate the release of catecholamines. The 5-HT1D receptor may function as an autoreceptor. Like 5-HT1B receptors, 5-HT1D receptors also appear to act as heteroreceptors. Acting on the 5-HT1D receptors, 5-HT appears to inhibit release of glutamate from rat cerebellar synaptosomes and acetylcholine from guinea pig hippocampal synaptosomes (5). It has been suggested that neurogenic inflammation and nociceptive activity within trigemino- vascular afferents. Endothelium-dependent relaxation in the pig coronary artery has been claimed to be mediated by 5-HT1D receptors (6). Like other members of the 5-HT1 family, 5-HT1D receptors are negatively coupled to adenylate cyclase.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC-Fr, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: EM, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for 5-HT1D Antibody (NBP2-92762) (0)
There are no publications for 5-HT1D Antibody (NBP2-92762).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for 5-HT1D Antibody (NBP2-92762) (0)
There are no reviews for 5-HT1D Antibody (NBP2-92762).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for 5-HT1D Antibody (NBP2-92762) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional 5-HT1D Products
Research Areas for 5-HT1D Antibody (NBP2-92762)
Find related products by research area.
|
Blogs on 5-HT1D