5-HT1D Antibody - Azide and BSA Free

Western Blot: 5-HT1D Antibody [NBP2-92762] - Analysis of extracts of various cell lines, using 5-HT1D at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

5-HT1D Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit 5-HT1D Antibody - Azide and BSA Free (NBP2-92762) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human HTR1D (NP_000855.1). RTAGHAATMIAIVWAISICISIPPLFWRQAKAQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HTR1D
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL.
  • Western Blot 1:500-1:2000
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for 5-HT1D Antibody - Azide and BSA Free

• 5HT1D
• 5-HT1D
• 5-HT-1D
• 5-HT-1D-alpha
• 5-HT1DHTR1DA
• 5-hydroxytryptamine (serotonin) receptor 1D
• HT1DA
• HTR1D
• HTR1DA
• HTRL
• RDC4
• RDC4,5-hydroxytryptamine receptor 1D
• Serotonin receptor 1D

Background

Serotonin (5-hydroxytryptamine, 5-HT), originally discovered as a serum factor plays important roles in regulating diverse biological processes in central and peripheral nervous systems, cardiovascular systems, and gastrointestinal systems (1,2). The 5-HT1D (formerly known as 5-HT1Da) receptor has 63% overall structural homology with the 5-HT1B receptor and a 77% amino acid sequence homology in the seven transmembrane domains (3). In situ hybridization studies have detected highest level of mRNA in primary olfactory cortex, accumbens nucleus, caudate putamen, lateral mammilary nucleus and medial vestibular nucleus (4). The presence of relatively high levels of 5-HT1D mRNA in the locus coeruleus suggest that, when expressed on nerve terminals, this receptor could modulate the release of catecholamines. The 5-HT1D receptor may function as an autoreceptor. Like 5-HT1B receptors, 5-HT1D receptors also appear to act as heteroreceptors. Acting on the 5-HT1D receptors, 5-HT appears to inhibit release of glutamate from rat cerebellar synaptosomes and acetylcholine from guinea pig hippocampal synaptosomes (5). It has been suggested that neurogenic inflammation and nociceptive activity within trigemino- vascular afferents. Endothelium-dependent relaxation in the pig coronary artery has been claimed to be mediated by 5-HT1D receptors (6). Like other members of the 5-HT1 family, 5-HT1D receptors are negatively coupled to adenylate cyclase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: HTR1D