5-HT1F Antibody

Images

 
Immunohistochemistry: 5-HT1F Antibody [NBP1-90319] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

5-HT1F Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HTR1F
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
5-HT1F Protein (NBP1-90319PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for 5-HT1F Antibody

  • 5HT1F
  • 5-HT1F
  • 5-HT-1F
  • 5HT6
  • 5-hydroxytryptamine (serotonin) receptor 1F
  • HTR1EL
  • HTR1ELMR77,5-HT1F5-hydroxytryptamine receptor 1F
  • HTR1F
  • MR77
  • Serotonin receptor 1F

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56349
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NB100-56352
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NBP1-46557
Species: Mu, Rt
Applications: WB, IHC
NBP1-90320
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-55429
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-78403
Species: Hu
Applications: WB, ICC/IF
NB120-16007
Species: Hu, Mu, Po, Ch, RM
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-90319
Species: Hu
Applications: IHC, IHC-P

Publications for 5-HT1F Antibody (NBP1-90319) (0)

There are no publications for 5-HT1F Antibody (NBP1-90319).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT1F Antibody (NBP1-90319) (0)

There are no reviews for 5-HT1F Antibody (NBP1-90319). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for 5-HT1F Antibody (NBP1-90319) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 5-HT1F Products

Bioinformatics Tool for 5-HT1F Antibody (NBP1-90319)

Discover related pathways, diseases and genes to 5-HT1F Antibody (NBP1-90319). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5-HT1F Antibody (NBP1-90319)

Discover more about diseases related to 5-HT1F Antibody (NBP1-90319).
 

Pathways for 5-HT1F Antibody (NBP1-90319)

View related products by pathway.

Research Areas for 5-HT1F Antibody (NBP1-90319)

Find related products by research area.

Blogs on 5-HT1F

There are no specific blogs for 5-HT1F, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 5-HT1F Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HTR1F
Entrez