5-HT1F Antibody - BSA Free

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.

Staining of human skin shows strong cytoplasmic positivity in basal cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

5-HT1F Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HTR1F
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  5-HT1F Protein (NBP1-90319PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for 5-HT1F Antibody - BSA Free

• 5HT1F
• 5-HT1F
• 5-HT-1F
• 5HT6
• 5-hydroxytryptamine (serotonin) receptor 1F
• HTR1EL
• HTR1ELMR77,5-HT1F5-hydroxytryptamine receptor 1F
• HTR1F
• MR77
• Serotonin receptor 1F

Background

The members of the G protein-coupled receptor family are distinguished by their slow transmitting response to ligand binding. These seven transmembrane proteins include the adrenergic, serotonin and dopamine receptors. The effect of the signaling molecule can be excitatory or inhibitory depending on the type of receptor to which it binds. beta-adrenergic bound to adrenaline activates adenylyl cyclase, while alpha2-adrenergic receptor bound to adrenaline inhibits adenylyl cyclase. Like the alpha2-adrenergic receptor, serotonin receptor functions are also mediated by G proteins that inhibit the activity of adenylyl cyclase. The serotonin receptors have been classified into several categories, designated SR-17 (5HT17). Subtypes within the SR-1 group include SR-1A, -1B, -1D, -1E and -1F.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HTR1F