5-HT1E Antibody - BSA Free

Immunohistochemistry-Paraffin: 5-HT1E Antibody [NBP1-90320] - Staining of human cerebral cortex shows moderate positivity in neuropil.

Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human endometrium shows moderate membranous positivity in glandular cells.

Analysis in control (vector only transfected HEK293T lysate) and HTR1E over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

5-HT1E Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit 5-HT1E Antibody - BSA Free (NBP1-90320) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRER
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HTR1E
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  5-HT1E Protein (NBP1-90320PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for 5-HT1E Antibody - BSA Free

• 5HT1E
• 5-HT1E
• 5-HT-1E
• 5-hydroxytryptamine (serotonin) receptor 1E
• HTR1E
• S31
• S31,5-HT1E5-hydroxytryptamine receptor 1E
• Serotonin receptor 1E

Background

5HT1E Receptor, also known as 5-hydroxytryptamine receptor 1E, is a 365 amino acid protein that is 42 kDa, belongs to the G-protein coupled receptor 1 family, has cell membrane intracellular location; commonly found in the cortex, caudate putamen, claustrum, hippocampus, and amygdala; is one of the many different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that plays a role of a neurotransmitter, a hormone, and a mitogen; this receptor activity is mediated by G proteins that inhibit adenylate cyclase activity. The protein is being studied for its involvement in attention deficit hyperactivity disorder, autism spectrum disorder, chronic fatigue syndrome, hermaphroditism, pharyngitis, neuronitis, and skin papilloma. This protein has been linked to the GPCR downstream signaling, GPCR ligand binding, class A/1 (Rhodopsin-like receptors), serotonin receptors, amine ligand-binding receptors, intracellular calcium signaling, signal transduction, G alpha (i) signaling events, neuroactive ligand-receptor interaction, and amine ligand-binding receptors pathways where it interacts with PSMC3, PSMC4, ADORA3, ADORA1, ADRA2A, APP, CCR3 and over 100 other proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HTR1E
• Entrez:
  • 3354(Human)
• Uniprot:
  • P28566(Human)