5-HT1E Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRER |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HTR1E |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for 5-HT1E Antibody - BSA Free
Background
5HT1E Receptor, also known as 5-hydroxytryptamine receptor 1E, is a 365 amino acid protein that is 42 kDa, belongs to the G-protein coupled receptor 1 family, has cell membrane intracellular location; commonly found in the cortex, caudate putamen, claustrum, hippocampus, and amygdala; is one of the many different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that plays a role of a neurotransmitter, a hormone, and a mitogen; this receptor activity is mediated by G proteins that inhibit adenylate cyclase activity. The protein is being studied for its involvement in attention deficit hyperactivity disorder, autism spectrum disorder, chronic fatigue syndrome, hermaphroditism, pharyngitis, neuronitis, and skin papilloma. This protein has been linked to the GPCR downstream signaling, GPCR ligand binding, class A/1 (Rhodopsin-like receptors), serotonin receptors, amine ligand-binding receptors, intracellular calcium signaling, signal transduction, G alpha (i) signaling events, neuroactive ligand-receptor interaction, and amine ligand-binding receptors pathways where it interacts with PSMC3, PSMC4, ADORA3, ADORA1, ADRA2A, APP, CCR3 and over 100 other proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC-Fr, Simple Western, WB
Species: Hu, Pm
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: WB, IHC
Publications for 5-HT1E Antibody (NBP1-90320) (0)
There are no publications for 5-HT1E Antibody (NBP1-90320).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for 5-HT1E Antibody (NBP1-90320) (0)
There are no reviews for 5-HT1E Antibody (NBP1-90320).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for 5-HT1E Antibody (NBP1-90320) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional 5-HT1E Products
Research Areas for 5-HT1E Antibody (NBP1-90320)
Find related products by research area.
|
Blogs on 5-HT1E