14-3-3 gamma Antibody - BSA Free

Western Blot: 14-3-3 gamma Antibody [NBP2-54679] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4

Immunohistochemistry-Paraffin: 14-3-3 gamma Antibody [NBP2-54679] - Staining of human cerebral cortex shows cytoplasmic and nuclear positivity in neuronal cells.

Western Blot: 14-3-3 gamma Antibody [NBP2-54679] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

14-3-3 gamma Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit 14-3-3 gamma Antibody - BSA Free (NBP2-54679) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids: EAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEIS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: YWHAG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  14-3-3 gamma Recombinant Protein Antigen (NBP2-54679PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for 14-3-3 gamma Antibody - BSA Free

• 1433 gamma
• 14-3-3 gamma
• 14-3-3 protein gamma
• 14-3-3GAMMA
• KCIP-1
• Protein kinase C inhibitor protein 1
• tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gammapolypeptide
• YWHAG

Background

14-3-3 protein gamma is a member of the 14-3-3 family of proteins which help mediate signal transduction. Specifically, 14-3-3 gamma is an adapter protein responsible for bringing signal transduction to completion. It therefore plays an important role in regulating many fundamental cellular processes, such as apoptosis and cell-cycle checkpoints.

Signal-induced phosphorylation has the ability to change protein function, however phosphorylation is not always enough to change a protein's function. 14-3-3 gamma has the ability to bind a large number of target proteins thereby affecting the proteins' activity and/or function.

14-3-3 gamma is highly expressed in brain, heart and skeletal muscle, where it is induced by growth factors in human vascular smooth muscle cells. This suggests that 14-3-3 gamma may play a role in muscle tissue function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: YWHAG