Zyxin Antibody (CL2502)

Images

 
Immunocytochemistry/ Immunofluorescence: Zyxin Antibody (CL2502) [NBP2-36768] - Staining in U251 cell line showing distinct focal adhesion staining in green. Microtubule-staining and nuclear probes are visualized in red ...read more
Immunohistochemistry: Zyxin Antibody (CL2502) [NBP2-36768] - Staining of human cerebral cortex shows absence of immunoreactivity in neuronal cells.
Immunocytochemistry/ Immunofluorescence: Zyxin Antibody (CL2502) [NBP2-36768] - Staining in HeLa cell line showing distinct focal adhesion staining in green. Microtubule-staining and nuclear probes are visualized in red ...read more
Immunocytochemistry/ Immunofluorescence: Zyxin Antibody (CL2502) [NBP2-36768] - Staining of human cell line A431 showing distinct focal adhesion staining in green. Microtubule-staining and nuclear probes are visualized ...read more
Immunocytochemistry/ Immunofluorescence: Zyxin Antibody (CL2502) [NBP2-36768] - Staining in MCF7 cell line showing distinct focal adhesion staining in green. Microtubule-staining and nuclear probes are visualized in red ...read more
Immunocytochemistry/ Immunofluorescence: Zyxin Antibody (CL2502) [NBP2-36768] - Staining in U2OS cell line with Anti-ZYX monoclonal antibody, showing distinct focal adhesion staining in green. Microtubule-staining and ...read more
Immunohistochemistry: Zyxin Antibody (CL2502) [NBP2-36768] - Staining of human kidney shows strong membranous and moderate cytoplasmic immunoreactivity in renal glomeruli and tubules.
Immunohistochemistry: Zyxin Antibody (CL2502) [NBP2-36768] - Staining of human skin shows strong cytoplasmic and membranous positivity in fibroblasts.
Immunohistochemistry: Zyxin Antibody (CL2502) [NBP2-36768] - Staining of human small intestine shows cytoplasmic and membranous immunoreactivity in lymphoid and smooth muscle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clone
CL2502
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Zyxin Antibody (CL2502) Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNE
Specificity
Specificity of human Zyxin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG2b
Clonality
Monoclonal
Host
Mouse
Gene
ZYX
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:5000-1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Zyxin Recombinant Protein Antigen (NBP2-36768PEP)

Reactivity Notes

Expected to cross react based on sequence identity: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Zyxin Antibody (CL2502)

  • CTCL tumor antigen se14-3
  • CTCL-associated antigen se14-3
  • cutaneous T-cell lymphoma associated antigen se14-3
  • Cutaneous T-cell lymphoma-associated antigen se14-3
  • KIAA1125
  • MGC31836
  • predicted protein of HQ2893
  • PRKCBP1
  • PRO2893
  • protein kinase C-binding protein 1
  • Rack7
  • RACK7protein kinase C binding protein 1
  • zinc finger MYND domain containing protein 8
  • Zinc finger MYND domain-containing protein 8
  • zinc finger, MYND-type containing 8
  • Zyx
  • Zyxin 2
  • Zyxin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85792
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr, ICC
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67427
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89549
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-79791
Species: Hu
Applications: WB
NBP1-82844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007837-Q01
Species: Hu
H00010096-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
AF1444
Species: Mu
Applications: WB, IHC

Publications for Zyxin Antibody (NBP2-36768) (0)

There are no publications for Zyxin Antibody (NBP2-36768).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Zyxin Antibody (NBP2-36768) (0)

There are no reviews for Zyxin Antibody (NBP2-36768). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Zyxin Antibody (NBP2-36768) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Zyxin Antibody (NBP2-36768)

Discover related pathways, diseases and genes to Zyxin Antibody (NBP2-36768). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Zyxin Antibody (NBP2-36768)

Discover more about diseases related to Zyxin Antibody (NBP2-36768).
 

Pathways for Zyxin Antibody (NBP2-36768)

View related products by pathway.

PTMs for Zyxin Antibody (NBP2-36768)

Learn more about PTMs related to Zyxin Antibody (NBP2-36768).
 

Research Areas for Zyxin Antibody (NBP2-36768)

Find related products by research area.

Blogs on Zyxin

There are no specific blogs for Zyxin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Zyxin Antibody (CL2502) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZYX
Entrez
Uniprot