ZNHIT6 Antibody

Images

 
Western Blot: ZNHIT6 Antibody [NBP1-88683] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: ZNHIT6 Antibody [NBP1-88683] - Staining of human cell line U-2 OS shows localization to nuclear speckles & vesicles.
Immunohistochemistry-Paraffin: ZNHIT6 Antibody [NBP1-88683] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNHIT6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KEELMHGECVKEEKDFLKKEIVDDTKVKEEPPINHPVGCKRKLAMSRCETCGTEEAKYRCPRCMRYSCSLPCVKKHKAELTCNGVRDKTAYISIQQFTEMNLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNHIT6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNHIT6 Protein (NBP1-88683PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNHIT6 Antibody

  • BCD1chromosome 1 open reading frame 181
  • box C/D snoRNA essential 1 homolog
  • box C/D snoRNA protein 1
  • C1orf181
  • FLJ12602
  • FLJ20729
  • FLJ20760
  • MGC131963
  • NY-BR-75
  • Serologically defined breast cancer antigen NY-BR-75
  • Zinc finger HIT domain-containing protein 6
  • zinc finger, HIT type 6
  • zinc finger, HIT-type containing 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3499
Species: Hu
Applications: WB
NBP2-19607
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38952
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32732
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84463
Species: Hu
Applications: IHC, IHC-P
NBP1-84466
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20245
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-14952
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90117
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1177
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP1-40354
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
H00151648-M01
Species: Hu
Applications: WB, ELISA, IP
NBP2-34837PEP
Species: Hu
Applications: AC
NBP2-24700
Species: Hu
Applications: WB
NBP1-83323
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92269
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4069
Species: Hu, Mu, Rt
Applications: WB
NBP1-88683
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZNHIT6 Antibody (NBP1-88683) (0)

There are no publications for ZNHIT6 Antibody (NBP1-88683).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNHIT6 Antibody (NBP1-88683) (0)

There are no reviews for ZNHIT6 Antibody (NBP1-88683). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNHIT6 Antibody (NBP1-88683) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNHIT6 Products

Bioinformatics Tool for ZNHIT6 Antibody (NBP1-88683)

Discover related pathways, diseases and genes to ZNHIT6 Antibody (NBP1-88683). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNHIT6 Antibody (NBP1-88683)

Discover more about diseases related to ZNHIT6 Antibody (NBP1-88683).

Blogs on ZNHIT6

There are no specific blogs for ZNHIT6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNHIT6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNHIT6