ZNHIT1 Antibody - BSA Free

Immunohistochemistry-Paraffin: ZNHIT1 Antibody [NBP1-85673] - Staining of human fallopian tube shows moderate nuclear and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ZNHIT1 Antibody [NBP1-85673] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: ZNHIT1 Antibody [NBP1-85673] - Staining of human placenta shows strong positivity in trophoblastic cells.

Analysis in human cell line HEK 293.

Staining of human cell line A-431 shows localization to nucleoplasm.

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNHIT1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNHIT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZNHIT1 Protein (NBP1-85673PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZNHIT1 Antibody - BSA Free

• CG1I
• CGBP1
• Cyclin-G1-binding protein 1
• H_DJ0747G18.14
• p18 Hamlet
• p18Hamlet
• putative cyclin G1 interacting protein
• zinc finger HIT domain-containing protein 1
• Zinc finger protein subfamily 4A member 1
• zinc finger protein, subfamily 4A (HIT domain containing), member 1
• zinc finger, HIT domain containing 1
• zinc finger, HIT type 1
• zinc finger, HIT-type containing 1
• ZNFN4A1

Background

Seems to play a role in p53-mediated apoptosis induction

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNHIT1