ZNF827 Antibody

Images

 
Western Blot: ZNF827 Antibody [NBP1-80431] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF827 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human LOC152485. Peptide sequence VCKTKNMFERHLQIHLITRMFECDVCHKFMKTPEQLLEHKKCHTVPTGGL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF827
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against LOC152485 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF827 Antibody

  • zinc finger protein 827

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84311
Species: Hu
Applications: IHC, IHC-P
MAB3035
Species: Hu
Applications: Flow, CyTOF-ready, ICC, KO
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22288
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
7770-GT
Species: Hu
NBP1-77072
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-47373
Species: Hu
Applications: IHC, IHC-P
NBP2-33281
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2715
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83122
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6237
Species: Hu
Applications: WB, IHC
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-24493
Species: Hu, Bv, Ch, Eq, Op, Pm
Applications: WB
NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
NBP2-46205
Species: Hu
Applications: WB, IHC
NBP1-86474
Species: Hu
Applications: IHC, IHC-P

Publications for ZNF827 Antibody (NBP1-80431) (0)

There are no publications for ZNF827 Antibody (NBP1-80431).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF827 Antibody (NBP1-80431) (0)

There are no reviews for ZNF827 Antibody (NBP1-80431). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF827 Antibody (NBP1-80431) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ZNF827 Antibody (NBP1-80431)

Discover related pathways, diseases and genes to ZNF827 Antibody (NBP1-80431). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF827 Antibody (NBP1-80431)

Discover more about diseases related to ZNF827 Antibody (NBP1-80431).
 

Pathways for ZNF827 Antibody (NBP1-80431)

View related products by pathway.

Blogs on ZNF827

There are no specific blogs for ZNF827, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF827 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF827
Uniprot