![Western Blot: ZNF652 Antibody [NBP2-84360] - WB Suggested Anti-ZNF652 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Hela cell lysateZNF652 is supported by BioGPS gene expression data to be expressed in HeLa](http://images.novusbio.com/fullsize/ZNF652-Antibody-Western-Blot-NBP2-84360-img0002.jpg "Western Blot: ZNF652 Antibody [NBP2-84360] - WB Suggested Anti-ZNF652 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Hela cell lysateZNF652 is supported by BioGPS gene expression data to be expressed in HeLa")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit ZNF652 Antibody - BSA Free (NBP2-84360) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human ZNF652. Peptide sequence: RENSDDTEEEEEEVSYKREQIIVEVNLNNQTLNVSKGEKGVSSQSKETPV The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZNF652 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZNF652 |
![Immunohistochemistry-Paraffin: ZNF652 Antibody [NBP2-84360] - Rabbit Anti-ZNF652 antibody. Paraffin Embedded Tissue: Human Lung cell. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X](http://images.novusbio.com/fullsize/ZNF652-Antibody-Immunohistochemistry-Paraffin-NBP2-84360-img0001.jpg "Immunohistochemistry-Paraffin: ZNF652 Antibody [NBP2-84360] - Rabbit Anti-ZNF652 antibody. Paraffin Embedded Tissue: Human Lung cell. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X")
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Immunohistochemistry SHBG Antibody [Unconjugated]](https://images.novusbio.com/images2/SHBG_AF2656_Immunohistochemistry_7324.jpg)
![Western Blot SHBG Antibody [Unconjugated]](https://images.novusbio.com/images/af2656_human-shbg-affinity-purified-pab-western-blot-2642023152834..jpg)
![Immunohistochemistry SHBG Antibody [Unconjugated]](https://images.novusbio.com/images/af2656_human-shbg-affinity-purified-pab-8120255541789.jpg)
![Intracellular Staining by Flow Cytometry GFI-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/GFI1_AF3540_Flow_Cytometry_23623.jpg)
![Western Blot GFI-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af3540_human-gfi-1-affinity-purified-polyclonal-ab-41202412394973.jpg)
![Western Blot GFI-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af3540_human-gfi-1-affinity-purified-polyclonal-ab-41202412401266.jpg)
![Flow Cytometry TGF-beta RIII Antibody [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_RIII_AF-242-PB_Flow_Cytometry_3386.jpg)
![Immunohistochemistry TGF-beta RIII Antibody [Unconjugated]](https://images.novusbio.com/images2/TGFbeta_RIII_AF242PB_Immunohistochemistry_24178.jpg)
![Flow Cytometry TGF-beta RIII Antibody [Unconjugated]](https://images.novusbio.com/images2/af-242-pb_human-tgf-beta-riii-affinity-purified-polyclonal-ab-flow-cytometry-276202216543.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
