CBFA2T3 Antibody

Images

 
Western Blot: CBFA2T3 Antibody [NBP2-57636] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: CBFA2T3 Antibody [NBP2-57636] - Staining of human tonsil shows strong nuclear positivity in germinal and non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CBFA2T3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGPAPVDRKAKASAMPDSPAEVKTQPR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CBFA2T3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CBFA2T3 Recombinant Protein Antigen (NBP2-57636PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CBFA2T3 Antibody

  • core-binding factor, runt domain, alpha subunit 2; translocated to, 3
  • hMTG16
  • MTG16ETO2
  • MTG8-related protein 2
  • MTGR2MTG8-related gene 2
  • Myeloid translocation gene on chromosome 16 protein
  • protein CBFA2T3
  • Zinc finger MYND domain-containing protein 4
  • ZMYND4myeloid translocation gene 8 and 16b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55747
Species: Hu
Applications: ICC/IF, WB
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-34136
Species: Hu
Applications: IHC, IHC-P, WB
NB100-58824
Species: Hu, Mu
Applications: CHIP-SEQ, ChIP, IP, WB
NBP2-01488
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
AF3565
Species: Mu
Applications: IHC, IP, WB
NBP1-31362
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
H00009079-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-48693
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00006938-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP2-47940
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
NBP1-97753
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
MAB7650
Species: Mu
Applications: IHC, WB
AF3540
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP2-47572
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2726
Species: Hu
Applications: Flow, ICC, WB
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-57636
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CBFA2T3 Antibody (NBP2-57636) (0)

There are no publications for CBFA2T3 Antibody (NBP2-57636).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBFA2T3 Antibody (NBP2-57636) (0)

There are no reviews for CBFA2T3 Antibody (NBP2-57636). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CBFA2T3 Antibody (NBP2-57636) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CBFA2T3 Products

Bioinformatics Tool for CBFA2T3 Antibody (NBP2-57636)

Discover related pathways, diseases and genes to CBFA2T3 Antibody (NBP2-57636). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBFA2T3 Antibody (NBP2-57636)

Discover more about diseases related to CBFA2T3 Antibody (NBP2-57636).
 

Pathways for CBFA2T3 Antibody (NBP2-57636)

View related products by pathway.

PTMs for CBFA2T3 Antibody (NBP2-57636)

Learn more about PTMs related to CBFA2T3 Antibody (NBP2-57636).

Blogs on CBFA2T3

There are no specific blogs for CBFA2T3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CBFA2T3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CBFA2T3