ZNF559 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF559 Antibody [NBP2-31787] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ZNF559 Antibody [NBP2-31787] - Staining of human ovary shows strong nuclear positivity in ovarian stroma cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF559 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LVAVDWESHINTKWSAPQQNFLQGKTSSVVEMERNHFGEELFDFNQCEKALSEHS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF559
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF559 Protein (NBP2-31787PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF559 Antibody

  • MGC13105
  • NBLA00121
  • putative protein product of Nbla00121
  • zinc finger protein 559

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92280
Species: Hu
Applications: WB, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33409
Species: Hu
Applications: WB, ICC/IF
AF6347
Species: Hu
Applications: WB
AF4509
Species: Hu
Applications: WB, ICC
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
AF1246
Species: Mu
Applications: WB
NBP2-15339
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
1341-WF/CF
Species: Hu
NBP1-97946
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-45672
Species: Hu, Mu, Rt
Applications: WB
NBP1-90290
Species: Hu
Applications: IHC, IHC-P
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB

Publications for ZNF559 Antibody (NBP2-31787) (0)

There are no publications for ZNF559 Antibody (NBP2-31787).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF559 Antibody (NBP2-31787) (0)

There are no reviews for ZNF559 Antibody (NBP2-31787). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF559 Antibody (NBP2-31787) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF559 Products

Bioinformatics Tool for ZNF559 Antibody (NBP2-31787)

Discover related pathways, diseases and genes to ZNF559 Antibody (NBP2-31787). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF559 Antibody (NBP2-31787)

Discover more about diseases related to ZNF559 Antibody (NBP2-31787).
 

Pathways for ZNF559 Antibody (NBP2-31787)

View related products by pathway.

PTMs for ZNF559 Antibody (NBP2-31787)

Learn more about PTMs related to ZNF559 Antibody (NBP2-31787).

Blogs on ZNF559

There are no specific blogs for ZNF559, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF559 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF559
Uniprot