ZNF467 Antibody

Western Blot: ZNF467 Antibody [NBP1-92626] - Analysis in human cell line AN3-CA.

Immunocytochemistry/Immunofluorescence: ZNF467 Antibody [NBP1-92626] - Staining of human cell line PC-3 shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ZNF467 Antibody [NBP1-92626] - Staining of human testis shows strong nuclear and cytoplasmic positivity in Spermatogonia

Western Blot: ZNF467 Antibody [NBP1-92626] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Discontinued

ZNF467 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RETLEALSSLGFSVGQPEMAPQSEPREGSHNAQEQMSSSREERALGVCSGHEAPTPEEGAHTEQAEAPCRGQACSAQKAQPVGTCP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF467
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZNF467 Antibody

• ZABC1
• zinc finger protein 217

Background

ZNF467 is involved in transcriptional regulation. Binds with STAT3 the consensus sequence 5'-CTTCTGGGAAGA-3' of theacute phase response element (APRE). Transactivates several promoters including FOS and OSM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF467