ZNF447 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF447 Antibody [NBP1-87389] - Staining of human cell line A-431 shows positivity in nucleus, nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: ZNF447 Antibody [NBP1-87389] - Staining of human cerebral cortex shows strong nuclear positivity in most cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF447 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QFLGILPDKVRPWVVAQYPESCKKAASLVEGLADVLEEPGMLLGSPAGSSSILSDGVYERHMDPLLLPGELASPSQALGAGEIPAPSETPWLSPDPLFLEQRRVREAKTEEDGPANTEQKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZSCAN18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF447 Protein (NBP1-87389PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF447 Antibody

  • DKFZp586B1122
  • FLJ12895
  • FLJ38919
  • FLJ44152
  • MGC4074
  • MGC8682
  • zinc finger and SCAN domain containing 18
  • zinc finger and SCAN domain-containing protein 18
  • Zinc finger protein 447MGC2427
  • ZNF447

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3656
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NB300-135
Species: Hu, Mu, Rt, Po, Bv, Fe
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, ISH
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33988
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-77127
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00058524-R01
Species: Hu
NBP2-37397
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-32507
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85085
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37357
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-90042
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14331
Species: Hu
Applications: IHC, IHC-P
NBP2-41186
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-87389
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZNF447 Antibody (NBP1-87389) (0)

There are no publications for ZNF447 Antibody (NBP1-87389).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF447 Antibody (NBP1-87389) (0)

There are no reviews for ZNF447 Antibody (NBP1-87389). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF447 Antibody (NBP1-87389) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF447 Products

Bioinformatics Tool for ZNF447 Antibody (NBP1-87389)

Discover related pathways, diseases and genes to ZNF447 Antibody (NBP1-87389). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF447 Antibody (NBP1-87389)

Discover more about diseases related to ZNF447 Antibody (NBP1-87389).
 

Pathways for ZNF447 Antibody (NBP1-87389)

View related products by pathway.

PTMs for ZNF447 Antibody (NBP1-87389)

Learn more about PTMs related to ZNF447 Antibody (NBP1-87389).

Blogs on ZNF447

There are no specific blogs for ZNF447, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF447 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZSCAN18