ATP5G2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ATP5G2 Antibody [NBP3-35291] - Immunofluorescence analysis of L929 cells using ATP5G2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: ATP5G2 Antibody [NBP3-35291] - Western blot analysis of various lysates using ATP5G2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ATP5G2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ATP5G2 Antibody - BSA Free (NBP3-35291) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ATP5G2 (NP_001002031.1).
  
  Sequence:
  ATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP5G2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 15 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ATP5G2 Antibody - BSA Free

• ATP synthase lipid-binding protein, mitochondrial
• ATP synthase proteolipid P2
• ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9)
• ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9)
• ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)
• ATPase protein 9
• ATPase subunit c
• isoform 2
• mitochondrial ATP synthase, subunit C (subunit 9)

Background

The ATP5G2 gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis,utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATPsynthase is composed of two linke

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP5G2