![Western Blot: ZNF410 Antibody [NBP2-86919] - Host: Rabbit. Target Name: ZN410. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize2/ZNF410 Antibody-Western Blot-NBP2-86919-img0001.jpg "Western Blot: ZNF410 Antibody [NBP2-86919] - Host: Rabbit. Target Name: ZN410. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/ml")
| Reactivity | Hu, Mu, Bv, Ca, Eq, Gp, RbSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZNF410. Peptide sequence: GSPRSLSSVPDVTHHLVTMQSGRQSYEVSVLTAVNPQELLNQGDLTERRT The peptide sequence for this immunogen was taken from within the described region. |
| Predicted Species | Mouse (93%), Guinea Pig (100%), Bovine (100%), Rabbit (100%), Equine (100%), Canine (93%). Backed by our 100% Guarantee. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZNF410 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![Neuropilin-2 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Neuropilin-2 Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Diseases for ZNF410 Antibody (NBP2-86919)Discover more about diseases related to ZNF410 Antibody (NBP2-86919).
| Pathways for ZNF410 Antibody (NBP2-86919)View related products by pathway.
|
PTMs for ZNF410 Antibody (NBP2-86919)Learn more about PTMs related to ZNF410 Antibody (NBP2-86919).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZNF410 |
![Immunohistochemistry-Paraffin: VDR/NR1I1/Vitamin D Receptor Antibody (JA11-16) [NBP2-66778] - Analysis of paraffin-embedded rat colon tissue using anti-Vitamin D Receptor antibody. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0) for 20 minutes. The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the antibody at 1/100 dilution, for 30 minutes at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. Counter stained with hematoxylin and mounted with DPX.](http://images.novusbio.com/images2/VDR-NR1I1-Vitamin-D-Receptor-Antibody-(JA11-16)-Immunohistochemistry-Paraffin-NBP2-66778-img0007.jpg)
![Flow Cytometry: VDR/NR1I1/Vitamin D Receptor Antibody (JA11-16) [NBP2-66778] - Analysis of Hela cells with Vitamin D Receptor antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.](http://images.novusbio.com/images2/VDR-NR1I1-Vitamin-D-Receptor-Antibody-(JA11-16)-Flow-Cytometry-NBP2-66778-img0001.jpg)
![Immunohistochemistry-Paraffin: VDR/NR1I1/Vitamin D Receptor Antibody (JA11-16) [NBP2-66778] - Analysis of paraffin-embedded mouse skin tissue using anti-Vitamin D Receptor antibody. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0) for 20 minutes. The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the antibody at 1/100 dilution, for 30 minutes at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. Counter stained with hematoxylin and mounted with DPX.](http://images.novusbio.com/images2/VDR-NR1I1-Vitamin-D-Receptor-Antibody-(JA11-16)-Immunohistochemistry-Paraffin-NBP2-66778-img0006.jpg)
![Western Blot: CYP27B1 Antibody [NBP2-92637] - Analysis of extracts of various cell lines, using CYP27B1 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.](http://images.novusbio.com/images2/CYP27B1 Antibody-Western Blot-NBP2-92637-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: CYP27B1 Antibody [NBP2-92637] - Analysis of HeLa cells using CYP27B1. Blue: DAPI for nuclear staining.](http://images.novusbio.com/images2/CYP27B1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92637-img0001.jpg)
![Immunohistochemistry-Paraffin: CDX2 Antibody [NB100-2136] - FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-CDX2 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB](http://images.novusbio.com/images2/CDX2-Antibody-Immunohistochemistry-Paraffin-NB100-2136-img0006.jpg)
![Immunoprecipitation: CDX2 Antibody [NB100-2136] - Detection of Human CDX2 on HeLa whole cell lysate using NB100-2136. CDX2 was also immunoprecipitated by rabbit anti-CDX2 antibody NB100-2137 using 3 mcg/mg lysate.](http://images.novusbio.com/images2/CDX2-Antibody-Immunoprecipitation-NB100-2136-img0003.jpg)
![Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining in human skeletal muscle and tonsil tissues. Corresponding DMD RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Dystrophin-Antibody-Immunohistochemistry-Paraffin-NBP1-89953-img0010.jpg)
![Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human heart muscle shows strong membranous positivity in myocytes.](http://images.novusbio.com/images2/Dystrophin-Antibody-Immunohistochemistry-Paraffin-NBP1-89953-img0007.jpg)
![Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human skeletal muscle shows strong membranous positivity in myocytes.](http://images.novusbio.com/images2/Dystrophin-Antibody-Immunohistochemistry-Paraffin-NBP1-89953-img0008.jpg)
![Western Blot: TEF1 Antibody [NBP2-94035] - Analysis of extracts of various cell lines, using TEAD1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/images2/TEF1-Antibody-Western-Blot-NBP2-94035-img0012.jpg)
![Immunocytochemistry/Immunofluorescence: TEF1 Antibody [NBP2-94035] - Analysis of MCF7 cells using TEF1.](http://images.novusbio.com/images2/TEF1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-94035-img0002.jpg)
![Immunohistochemistry-Paraffin: TEF1 Antibody [NBP2-94035] - Mouse heart using TEAD1 Rabbit pAb at dilution of 1:100 (40x lens).](http://images.novusbio.com/images2/TEF1-Antibody-Immunohistochemistry-Paraffin-NBP2-94035-img0015.jpg)
![Dual RNAscope ISH-IHC: Bestrophin 1 Antibody (E6-6) [NB300-164] - Formalin-fixed paraffin-embedded tissue sections of human duodenum were probed for Bestrophin 1 mRNA (ACD RNAScope Probe, catalog # 433181; Fast Red chromogen, ACD catalog # 322360). Adjacent tissue section was processed for immunohistochemistry using mouse anti-human (Novus Biologicals catalog # NB300-164) at 0.3ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). IHC signal is confined to cytoplasm.](http://images.novusbio.com/images2/Bestrophin-1-Antibody-(E6-6)-Dual-RNAscope-ISH-IHC-NB300-164-img0006.jpg)
![Immunohistochemistry-Paraffin: Bestrophin 1 Antibody (E6-6) [NB300-164] - Bestrophin 1 was detected in immersion fixed paraffin sections of human small intestine using t Mouse Anti-Human Bestrophin 1 Monoclonal Antibody (Catalog # NB300-164) at 5 ug/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to the cell surface and extracellular.](http://images.novusbio.com/images2/Bestrophin-1-Antibody-(E6-6)-Immunohistochemistry-Paraffin-NB300-164-img0005.jpg)
![Western Blot: Bestrophin 1 Antibody (E6-6) [NB300-164] - Western blot analysis of the normal and mutant human Best1 protein in transiently transfected MDCK cells. Best1 proteins are detectable as a 68 kDa band in all transfected cells, but not in non-transfected controls (MDCK lane). Actin bands are shown to indicate equal loading of cell lysates. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/1422-0067/14/7/15121), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Bestrophin-1-Antibody-(E6-6)-Western-Blot-NB300-164-img0007.jpg)
![Western Blot: TFCP2 Antibody [H00007024-B01P] - Analysis of TFCP2 expression in NIH/3T3.](http://images.novusbio.com/images2/TFCP2-Antibody-Western-Blot-H00007024-B01P-img0005.jpg)
![Western Blot: TFCP2 Antibody [H00007024-B01P] - Analysis of TFCP2 expression in PC-12.](http://images.novusbio.com/images2/TFCP2-Antibody-Western-Blot-H00007024-B01P-img0003.jpg)
![Western Blot: TFCP2 Antibody [H00007024-B01P] - Analysis of TFCP2 expression in Hela S3 NE.](http://images.novusbio.com/images2/TFCP2-Antibody-Western-Blot-H00007024-B01P-img0004.jpg)
![ELISA: Human PTH ELISA Kit (Colorimetric) [NBP2-60629]](http://images.novusbio.com/images2/Human PTH ELISA Kit (Colorimetric)-ELISA-NBP2-60629-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: ALG9 Antibody [NBP1-90191] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/images2/ALG9-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90191-img0005.jpg)
![Immunohistochemistry-Paraffin: ALG9 Antibody [NBP1-90191] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/images2/ALG9-Antibody-Immunohistochemistry-Paraffin-NBP1-90191-img0001.jpg)
![Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Western-Blot-NBP2-34260-img0006.jpg)
![Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Immunohistochemistry-NBP2-34260-img0005.jpg)
![Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)](http://images.novusbio.com/images2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Immunohistochemistry-Paraffin-NBP2-34260-img0002.jpg)
![Western Blot: MTA1 Antibody [NB600-260] - Detection of Human and Mouse MTA1 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-MTA1 antibody NB600-260 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.](http://images.novusbio.com/images2/MTA1-Antibody-Western-Blot-NB600-260-img0007.jpg)
![Immunohistochemistry-Paraffin: MTA1 Antibody [NB600-260] - Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti- MTA1 used at a dilution of 1:1,000 (1 ug/ml). Detection: DAB](http://images.novusbio.com/images2/MTA1-Antibody-Immunohistochemistry-Paraffin-NB600-260-img0005.jpg)
![Immunoprecipitation: MTA1 Antibody [NB600-260] - Detection of human MTA1 by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-MTA1 antibody NB600-260 (lot NB600-260-2) used for IP at 6 ug per reaction. MTA1 was also immunoprecipitated by rabbit anti-MTA1 antibody NB600-260-1. For blotting immunoprecipitated MTA1, NB600-260 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.](http://images.novusbio.com/images2/MTA1-Antibody-Immunoprecipitation-NB600-260-img0008.jpg)
![Western Blot: KISS1 Antibody (1F7) [H00003814-M05] - Analysis of KISS1 expression in transfected 293T cell line by KISS1 monoclonal antibody (M05), clone 1F7. Lane 1: KISS1 transfected lysatE (14.7 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/KISS1-Antibody-(1F7)-Western-Blot-H00003814-M05-img0004.jpg)
![Immunohistochemistry-Paraffin: KISS1 Antibody (1F7) [H00003814-M05] - Analysis of monoclonal antibody to KISS1 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml](http://images.novusbio.com/images2/KISS1-Antibody-(1F7)-Immunohistochemistry-Paraffin-H00003814-M05-img0003.jpg)
![ELISA: KISS1 Antibody (1F7) [H00003814-M05] - Detection limit for recombinant GST tagged KISS1 is approximately 0.3ng/ml as a capture antibody.](http://images.novusbio.com/images2/KISS1-Antibody-(1F7)-ELISA-H00003814-M05-img0002.jpg)
![Immunohistochemistry: PD-ECGF/Thymidine Phosphorylase Antibody (PGF 44C) [NB100-2737] - Immunohistochemical staining of thymidine phosphorylase (TP) expression and related markers in benign lymph node. In benign lymph node, TP expression highlights the meshwork of macrophages (arrow in inset; 400x) and endothelial cells (arrowhead in inset; 400x). Images are from an Olympus BX41 microscope (Olympus Corp., Tokyo, Japan) processed with Qcapture Pro 5.1 (QImaging, Surrey, BC, Canada). Image collected and cropped by CiteAb from the following publication (http://www.hindawi.com/journals/ah/2011/875135/) licensed under a CC-BY licence.](http://images.novusbio.com/images2/PD-ECGF-Thymidine-Phosphorylase-Antibody-(PGF-44C)-Immunohistochemistry-NB100-2737-img0003.jpg)
![Immunohistochemistry: PD-ECGF/Thymidine Phosphorylase Antibody (PGF 44C) [NB100-2737] - Immunohistochemical staining of thymidine phosphorylase (TP) expression and related markers in benign lymph node in lymph node with malignant mycosis fungoides/Sezary syndrome cells (LN-MF). CD21 is negative in this case of LN-MF. Images are from an Olympus BX41 microscope (Olympus Corp., Tokyo, Japan) processed with Qcapture Pro 5.1 (QImaging, Surrey, BC, Canada). Image collected and cropped by CiteAb from the following publication (http://www.hindawi.com/journals/ah/2011/875135/) licensed under a CC-BY licence.](http://images.novusbio.com/images2/PD-ECGF-Thymidine-Phosphorylase-Antibody-(PGF-44C)-Immunohistochemistry-NB100-2737-img0008.jpg)
![Immunohistochemistry-Paraffin: PD-ECGF/Thymidine Phosphorylase Antibody (PGF 44C) [NB100-2737] - Analysis of Thymidine Phosphorylase formalin-fixed paraffin embedded human breast carcinoma.](http://images.novusbio.com/images2/PD-ECGF-Thymidine-Phosphorylase-Antibody-(PGF-44C)-Immunohistochemistry-Paraffin-NB100-2737-img0002.jpg)