ZNF410 Antibody

Images

 
Western Blot: ZNF410 Antibody [NBP2-86919] - Host: Rabbit. Target Name: ZN410. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Mu, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF410 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZNF410. Peptide sequence: GSPRSLSSVPDVTHHLVTMQSGRQSYEVSVLTAVNPQELLNQGDLTERRT The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Guinea Pig (100%), Bovine (100%), Rabbit (100%), Equine (100%), Canine (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF410
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF410 Antibody

  • DKFZp781N1974
  • gene similar to zinc finger 5 protein10
  • ZBTB21KIAA1227
  • Zinc finger and BTB domain-containing protein 21
  • zinc finger protein 295

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66778
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-92637
Species: Hu, Rt
Applications: WB, ICC/IF
NB100-2136
Species: Hu, Mu
Applications: WB (-), IHC, IHC-P, IP
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-94035
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB300-164
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Dual ISH-IHC
H00007024-B01P
Species: Hu, Mu, Rt
Applications: WB
AF2215
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, IHC, Block, CyTOF-ready
MAB1981
Species: Hu, Mu
Applications: Flow, CyTOF-ready, ICC
NBP1-90191
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-260
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00003814-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2737
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for ZNF410 Antibody (NBP2-86919) (0)

There are no publications for ZNF410 Antibody (NBP2-86919).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF410 Antibody (NBP2-86919) (0)

There are no reviews for ZNF410 Antibody (NBP2-86919). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF410 Antibody (NBP2-86919) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZNF410 Products

Bioinformatics Tool for ZNF410 Antibody (NBP2-86919)

Discover related pathways, diseases and genes to ZNF410 Antibody (NBP2-86919). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF410 Antibody (NBP2-86919)

Discover more about diseases related to ZNF410 Antibody (NBP2-86919).
 

Pathways for ZNF410 Antibody (NBP2-86919)

View related products by pathway.

PTMs for ZNF410 Antibody (NBP2-86919)

Learn more about PTMs related to ZNF410 Antibody (NBP2-86919).

Blogs on ZNF410

There are no specific blogs for ZNF410, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF410 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF410