ZNF342 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF342 Antibody [NBP2-13565] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and vesicles.
Immunohistochemistry-Paraffin: ZNF342 Antibody [NBP2-13565] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF342 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GKQFTVAWKLLRHAQWDHGLSIYQTESEAPEAPLLGLAEVAAAVSAVVGP AAEAKSPRASGSGLTRRSPTCPVCKKTLSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF296
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF342 Protein (NBP2-13565PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF342 Antibody

  • MRX89MGC8941
  • zinc finger protein 41

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-80699
Species: Hu
Applications: IHC, IHC-P
AF1924
Species: Hu
Applications: WB, Simple Western, ChIP, ICC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
AF674
Species: Hu
Applications: WB, Simple Western, Neut
AF3158
Species: Mu
Applications: WB, ChIP, ICC
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP2-20398
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF3629
Species: Hu, Mu, Rt
Applications: WB, Neut
H00079760-M09
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NB100-56637
Species: Hu, Mu
Applications: WB
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13565
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZNF342 Antibody (NBP2-13565) (0)

There are no publications for ZNF342 Antibody (NBP2-13565).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF342 Antibody (NBP2-13565) (0)

There are no reviews for ZNF342 Antibody (NBP2-13565). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF342 Antibody (NBP2-13565) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF342 Products

Bioinformatics Tool for ZNF342 Antibody (NBP2-13565)

Discover related pathways, diseases and genes to ZNF342 Antibody (NBP2-13565). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF342

There are no specific blogs for ZNF342, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF342 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF296