ZNF217 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF217 Antibody [NBP2-13561] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: ZNF217 Antibody [NBP2-13561] - Staining of human stomach, upper shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF217 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QTDVAAEVKNDGKNQDTEDALLTADSAQTKNLKRFFDGAKDVTGSPPAKQ LKEMPSVFQNVLGSAVLSPAHKDTQDFHKNAADDSADKVNK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF217
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF217 Protein (NBP2-13561PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF217 Antibody

  • DKFZp781O2147
  • KIAA0335
  • MGC125707
  • MGC125710
  • zinc finger protein 518
  • zinc finger protein 518A
  • ZNF518

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33930
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-240
Species: Hu
Applications: WB, IHC-P, PLA
AF1366
Species: Hu
Applications: WB, Simple Western, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-314
Species: Hu
Applications: WB, IP, PLA
NB100-97821
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1762
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ChIP, ELISA, IHC, IHC-P
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46360
Species: Hu
Applications: WB, IHC
NBP2-13561
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZNF217 Antibody (NBP2-13561) (0)

There are no publications for ZNF217 Antibody (NBP2-13561).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF217 Antibody (NBP2-13561) (0)

There are no reviews for ZNF217 Antibody (NBP2-13561). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF217 Antibody (NBP2-13561) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF217 Products

Bioinformatics Tool for ZNF217 Antibody (NBP2-13561)

Discover related pathways, diseases and genes to ZNF217 Antibody (NBP2-13561). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF217 Antibody (NBP2-13561)

Discover more about diseases related to ZNF217 Antibody (NBP2-13561).
 

Pathways for ZNF217 Antibody (NBP2-13561)

View related products by pathway.

PTMs for ZNF217 Antibody (NBP2-13561)

Learn more about PTMs related to ZNF217 Antibody (NBP2-13561).

Blogs on ZNF217

There are no specific blogs for ZNF217, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF217 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF217