ZNF217 Antibody

The staining of human cell lines in U-2 OS shows localization to nuclear speckles.

Product Discontinued

ZNF217 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: QTDVAAEVKNDGKNQDTEDALLTADSAQTKNLKRFFDGAKDVTGSPPAKQLKEMPSVFQNVLGSAVLSPAHKDTQDFHKNAADDSADKVNK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF217
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZNF217 Antibody

• DKFZp781O2147
• KIAA0335
• MGC125707
• MGC125710
• zinc finger protein 518
• zinc finger protein 518A
• ZNF518

Background

ZNF217 binds to the promoters of target genes and functions as repressor. Promotes cell proliferation and antagonizes cell death. Promotes phosphorylation of AKT1 at 'Ser-473'

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF217