ZNF202 Antibody (1E9)

Images

 
Immunohistochemistry-Paraffin: ZNF202 Antibody (1E9) [H00007753-M01] - Analysis of monoclonal antibody to ZNF202 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml.
Sandwich ELISA: ZNF202 Antibody (1E9) [H00007753-M01] - Detection limit for recombinant GST tagged ZNF202 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC
Clone
1E9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF202 Antibody (1E9) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
ZNF202 (NP_003446, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QEPQETQEPEILSFTYTGDRSKDEEECLEQEDLSLEDIHRPVLGEPEIHQTPDWEIVFEDNPGRLNERRFGTNISQVNSFVNLRETTPVHPLLGRHHDCS
Specificity
ZNF202 - zinc finger protein 202
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF202
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF202 Antibody (1E9)

  • zinc finger protein 202
  • ZKSCAN10Zinc finger protein with KRAB and SCAN domains 10

Background

Transcriptional repressor that binds to elements found predominantly in genes that participate in lipid metabolism. Among its targets are structural components of lipoprotein particles (apolipoproteins AIV, CIII, and E), enzymes involved in lipid processing (lipoprotein lipase, lecithin cholesteryl ester transferase), transporters involved in lipid homeostasis (ABCA1, ABCG1), and several genes involved in processes related to energy metabolism and vascular disease

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF202 Antibody (H00007753-M01) (0)

There are no publications for ZNF202 Antibody (H00007753-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF202 Antibody (H00007753-M01) (0)

There are no reviews for ZNF202 Antibody (H00007753-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF202 Antibody (H00007753-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF202 Antibody (1E9) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF202
Entrez
OMIM
Uniprot