ZNF202 Antibody (1E9)

Images

 
Immunohistochemistry-Paraffin: ZNF202 Antibody (1E9) [H00007753-M01] - Analysis of monoclonal antibody to ZNF202 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml.
Sandwich ELISA: ZNF202 Antibody (1E9) [H00007753-M01] - Detection limit for recombinant GST tagged ZNF202 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
1E9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF202 Antibody (1E9) Summary

Immunogen
ZNF202 (NP_003446 301 a.a. - 400 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QEPQETQEPEILSFTYTGDRSKDEEECLEQEDLSLEDIHRPVLGEPEIHQTPDWEIVFEDNPGRLNERRFGTNISQVNSFVNLRETTPVHPLLGRHHDCS
Specificity
ZNF202 - zinc finger protein 202
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF202
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF202 Antibody (1E9)

  • zinc finger protein 202
  • ZKSCAN10Zinc finger protein with KRAB and SCAN domains 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP2-56092
Species: Hu
Applications: WB, ICC/IF
MAB6799
Species: Hu
Applications: WB, IHC
NB400-132
Species: Hu, Mu, Rt, ChHa, Ha, Mk, Rb
Applications: WB, ICC/IF, IHC, IHC-P, In vitro
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NB400-118
Species: Hu, Mu(-)
Applications: WB, ELISA, ICC/IF
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-36489
Species: Hu
Applications: WB, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1924
Species: Hu
Applications: WB, Simple Western, ChIP, ICC
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
NBP2-01245
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-28884
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for ZNF202 Antibody (H00007753-M01) (0)

There are no publications for ZNF202 Antibody (H00007753-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF202 Antibody (H00007753-M01) (0)

There are no reviews for ZNF202 Antibody (H00007753-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF202 Antibody (H00007753-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF202 Products

Bioinformatics Tool for ZNF202 Antibody (H00007753-M01)

Discover related pathways, diseases and genes to ZNF202 Antibody (H00007753-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF202 Antibody (H00007753-M01)

Discover more about diseases related to ZNF202 Antibody (H00007753-M01).
 

Pathways for ZNF202 Antibody (H00007753-M01)

View related products by pathway.

PTMs for ZNF202 Antibody (H00007753-M01)

Learn more about PTMs related to ZNF202 Antibody (H00007753-M01).

Blogs on ZNF202

There are no specific blogs for ZNF202, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF202 Antibody (1E9) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF202
Entrez
OMIM
Uniprot