ZNF2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF2 Antibody [NBP1-89340] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry: ZNF2 Antibody [NBP1-89340] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LDWETKPEIHDASDKKSEGSLRECLGRQSPLCPKFEVHTPNGRMGTEKQSPSGETRKKSLSRDKGLRR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF2 Protein (NBP1-89340PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF2 Antibody

  • A1-5
  • Zfp661
  • zinc finger protein 2 (A1-5)
  • zinc finger protein 2
  • Zinc finger protein 2.2
  • ZNF661Zinc finger protein 661

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP2-13568
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6897
Species: Hu, Mu
Applications: WB, IHC
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for ZNF2 Antibody (NBP1-89340) (0)

There are no publications for ZNF2 Antibody (NBP1-89340).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF2 Antibody (NBP1-89340) (0)

There are no reviews for ZNF2 Antibody (NBP1-89340). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF2 Antibody (NBP1-89340) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF2 Products

Bioinformatics Tool for ZNF2 Antibody (NBP1-89340)

Discover related pathways, diseases and genes to ZNF2 Antibody (NBP1-89340). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF2 Antibody (NBP1-89340)

Discover more about diseases related to ZNF2 Antibody (NBP1-89340).
 

Pathways for ZNF2 Antibody (NBP1-89340)

View related products by pathway.

Blogs on ZNF2

There are no specific blogs for ZNF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF2