ZNF354A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF354A Antibody [NBP2-13568] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus, nucleoli & cytosol.
Immunohistochemistry-Paraffin: ZNF354A Antibody [NBP2-13568] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF354A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TQDSSFQGLILKRSNRNVPWDLKLEKPYIYEGRLEKKQDKKGSFQIVSAT HKKIPTIERSHKNTELSQNFSPKSVLIRQQILPR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF354A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF354A Protein (NBP2-13568PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF354A Antibody

  • G0/G1 switch regulatory protein 24
  • G0S24tristetraprolin
  • Growth factor-inducible nuclear protein NUP475
  • NUP475
  • Protein TIS11A
  • RNF162Atristetraproline
  • TIS11A
  • TIS11zfp-36
  • TTPGOS24
  • Zfp-36
  • Zinc finger protein 36 homolog
  • zinc finger protein 36, C3H type, homolog (mouse)
  • zinc finger protein, C3H type, 36 homolog (mouse)
  • zinc finger protein, C3H type, 36 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-13408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00150094-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NBP1-82064
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF877
Species: Hu
Applications: WB, IHC, IP
NBP1-85789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-50553
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-83764
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for ZNF354A Antibody (NBP2-13568) (0)

There are no publications for ZNF354A Antibody (NBP2-13568).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF354A Antibody (NBP2-13568) (0)

There are no reviews for ZNF354A Antibody (NBP2-13568). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF354A Antibody (NBP2-13568) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF354A Products

Bioinformatics Tool for ZNF354A Antibody (NBP2-13568)

Discover related pathways, diseases and genes to ZNF354A Antibody (NBP2-13568). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF354A Antibody (NBP2-13568)

Discover more about diseases related to ZNF354A Antibody (NBP2-13568).
 

Pathways for ZNF354A Antibody (NBP2-13568)

View related products by pathway.

PTMs for ZNF354A Antibody (NBP2-13568)

Learn more about PTMs related to ZNF354A Antibody (NBP2-13568).

Blogs on ZNF354A

There are no specific blogs for ZNF354A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF354A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF354A