ZNF198 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RLSFGTVFRHWKKNPLTMENKACLRYQVSSLCGTDNEDKITTGKRKHEDDEPVFEQIENTANPSRCPVKMFECYLSKSPQN |
Predicted Species |
Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ZMYM2 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Publications |
|
Reactivity Notes
Reactivity reported in scientific literature (PMID: 23435261)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for ZNF198 Antibody
Background
Official Gene Symbol: ZMYM2 Gen Bank Accession Number: NP_932072 Gene ID: 7750 (Human) Gene Map Locus: 13q11-q12 (Human) ZNF198 is a ubiquitously expressed nuclear protein whose physiological role is largely unknown. It consists of 5 N-terminal zinc finger motifs responsible for protein-protein interactions, a central proline-rich domain and C-terminal nuclear localization signal (NLS) and an acidic domain. Reciprocal chromosomal translocation involving ZNF198 and FGFR1 results in the formation of ZNF198/FGFR1 fusion kinase protein. This fusion protein is a ligand-dependent, constitutively active cytoplasmic tyrosine kinase and regulates several STAT transcription factors including STAT 1, 3 and 5. This fusion protein is an oncogenic protein and is associated with an atypical myeloproliferative disease, peripheral blood eosinophilia and T-cell leukemia/lymphoma.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Eq, Gt, Ha, Hu, Pm, Po, Pm, Rb, Rt, Xp
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, KO
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Publications for ZNF198 Antibody (NBP1-84685)(1)
Showing Publication 1 -
1 of 1.
Reviews for ZNF198 Antibody (NBP1-84685) (0)
There are no reviews for ZNF198 Antibody (NBP1-84685).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ZNF198 Antibody (NBP1-84685) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ZNF198 Products
Bioinformatics Tool for ZNF198 Antibody (NBP1-84685)
Discover related pathways, diseases and genes to ZNF198 Antibody (NBP1-84685). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for ZNF198 Antibody (NBP1-84685)
Discover more about diseases related to ZNF198 Antibody (NBP1-84685).
| | Pathways for ZNF198 Antibody (NBP1-84685)
View related products by pathway.
|
PTMs for ZNF198 Antibody (NBP1-84685)
Learn more about PTMs related to ZNF198 Antibody (NBP1-84685).
|
Blogs on ZNF198