![Western Blot: ZNF177 Antibody [NBP3-05074] - Paraffin-embedded mouse brain using ZNF177 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/ZNF177-Antibody-Western-Blot-NBP3-05074-img0005.jpg "Western Blot: ZNF177 Antibody [NBP3-05074] - Paraffin-embedded mouse brain using ZNF177 antibody at dilution of 1:100 (40x lens).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit ZNF177 Antibody - Azide and BSA Free (NBP3-05074) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-110 of human ZNF177 (NP_003442.2). LASVGYQLCRHSLISKVDQEQLKTDERGILQGDCADWETQLKPKDTIAMQNIPGGKTSNGI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZNF177 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZNF177 |
![Immunocytochemistry/Immunofluorescence: ZNF177 Antibody [NBP3-05074] - Analysis of U-2 OS cells using ZNF177 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/ZNF177-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-05074-img0003.jpg "Immunocytochemistry/Immunofluorescence: ZNF177 Antibody [NBP3-05074] - Analysis of U-2 OS cells using ZNF177 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: ZNF177 Antibody [NBP3-05074] - Paraffin-embedded mouse kidney using ZNF177 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/ZNF177-Antibody-Immunohistochemistry-Paraffin-NBP3-05074-img0006.jpg "Immunohistochemistry-Paraffin: ZNF177 Antibody [NBP3-05074] - Paraffin-embedded mouse kidney using ZNF177 antibody at dilution of 1:100 (40x lens).")
![Immunocytochemistry/Immunofluorescence: ZNF177 Antibody [NBP3-05074] - Analysis of C6 cells using ZNF177 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/ZNF177-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-05074-img0001.jpg "Immunocytochemistry/Immunofluorescence: ZNF177 Antibody [NBP3-05074] - Analysis of C6 cells using ZNF177 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: ZNF177 Antibody [NBP3-05074] - Analysis of NIH-3T3 cells using ZNF177 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/ZNF177-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-05074-img0002.jpg "Immunocytochemistry/Immunofluorescence: ZNF177 Antibody [NBP3-05074] - Analysis of NIH-3T3 cells using ZNF177 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: ZNF177 Antibody [NBP3-05074] - Paraffin-embedded rat pancreas using ZNF177 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/ZNF177-Antibody-Immunohistochemistry-Paraffin-NBP3-05074-img0004.jpg "Immunohistochemistry-Paraffin: ZNF177 Antibody [NBP3-05074] - Paraffin-embedded rat pancreas using ZNF177 antibody at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: ZNF177 Antibody [NBP3-05074] - Paraffin-embedded mouse pancreas using ZNF177 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/ZNF177-Antibody-Immunohistochemistry-Paraffin-NBP3-05074-img0007.jpg "Immunohistochemistry-Paraffin: ZNF177 Antibody [NBP3-05074] - Paraffin-embedded mouse pancreas using ZNF177 antibody at dilution of 1:100 (40x lens).")
![Western Blot IRS2 Antibody (676415) [Unconjugated]](https://images.novusbio.com/images2/IRS2_MAB6347_Western_Blot_11857.jpg)
![Western Blot TBX3 Antibody [Unconjugated]](https://images.novusbio.com/images2/TBX3_AF4509_Western_Blot_5482.jpg)
![Immunocytochemistry TBX3 Antibody [Unconjugated]](https://images.novusbio.com/images2/TBX3_AF4509_Immunocytochemistry__Immunofluorescence_23053.jpg)
![Western Blot TBX3 Antibody [Unconjugated]](https://images.novusbio.com/images2/af4509_human-tbx3-affinity-purified-polyclonal-ab-western-blot-1182021152353.jpg)
![Bioactivity BMP-7 [Unconjugated]](https://images.novusbio.com/images/protein/354-bp_recombinant-human-bmp-7-protein-bioactivity-7122020141940.jpg)
![Cell Culture BMP-7 [Unconjugated]](https://images.novusbio.com/images/354-bp_recombinant-human-bmp-7-protein-cell-culture-252023113257..jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0001.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0003.jpg)
![Enzyme Activity u-Plasminogen Activator/Urokinase [Unconjugated]](https://images.novusbio.com/images2/uPlasminogen_Activator_1310SE_1837.jpg)
![N/A ULBP-2 [Biotin]](https://images.novusbio.com/images2/DATA_ULBP2_DY1298_ELISA_1620.jpg)
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/Follistatin_DFN00_ELISA_97.jpg)
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/DATA_Follistatin_DFN00_ELISA_681.jpg)
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/DATA_Follistatin_DFN00_ELISA_682.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")