ZNF177 Antibody

Images

 
Western Blot: ZNF177 Antibody [NBP1-86523] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: ZNF177 Antibody [NBP1-86523] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF177 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TWSQNSVTFQEVAVDFSQEEWALLDPAQKNLYKDVMLENFRNLASVGYQLCRHSLISKVDQEQLKTDERGILQGDCADWETQLKPKDTIAMQNIPGGKTSNGINTNCVRTHSGEMP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF177
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZNF177 Protein (NBP1-86523PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF177 Antibody

  • PIGX
  • zinc finger protein 177

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13761
Species: Hu
Applications: IHC, IHC-P
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33409
Species: Hu
Applications: WB, ICC/IF
AF6347
Species: Hu
Applications: WB
AF4509
Species: Hu
Applications: WB, ICC
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP2-31787
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-97946
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-45672
Species: Hu, Mu, Rt
Applications: WB
NBP1-90290
Species: Hu
Applications: IHC, IHC-P
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37343
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NLS1927
Species: Hu, Po, Bv, Gt
Applications: IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP

Publications for ZNF177 Antibody (NBP1-86523) (0)

There are no publications for ZNF177 Antibody (NBP1-86523).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF177 Antibody (NBP1-86523) (0)

There are no reviews for ZNF177 Antibody (NBP1-86523). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF177 Antibody (NBP1-86523) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF177 Products

Bioinformatics Tool for ZNF177 Antibody (NBP1-86523)

Discover related pathways, diseases and genes to ZNF177 Antibody (NBP1-86523). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF177 Antibody (NBP1-86523)

Discover more about diseases related to ZNF177 Antibody (NBP1-86523).
 

Pathways for ZNF177 Antibody (NBP1-86523)

View related products by pathway.

PTMs for ZNF177 Antibody (NBP1-86523)

Learn more about PTMs related to ZNF177 Antibody (NBP1-86523).

Blogs on ZNF177

There are no specific blogs for ZNF177, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF177 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF177