![Immunocytochemistry/Immunofluorescence: ZNF133 Antibody [NBP1-80914] - Staining of human cell line U-2 OS shows localization to vesicles.](http://images.novusbio.com/fullsize/ZNF133-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80914-img0008.jpg "Immunocytochemistry/Immunofluorescence: ZNF133 Antibody [NBP1-80914] - Staining of human cell line U-2 OS shows localization to vesicles.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit ZNF133 Antibody - BSA Free (NBP1-80914) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SKPELITQLEQGKETWREEKKCSPATCPADPEPELYLDPFCPPGFSSQKFPMQHVLCNHPPWIFTCLCAEGNIQPGDPGPGDQEKQQQASEGRPWSDQAEGPEGEGAMPLFGRTKKRTLG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZNF133 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT1_AF2894_Western_Blot_5226.jpg)
![Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/16351.jpg)
![Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT1_AF2894_Flow_Cytometry_8189.jpg)
![Immunohistochemistry MYH7 Antibody (940906) [Unconjugated]](https://images.novusbio.com/images2/MYH7_MAB9096_Immunohistochemistry_19508.jpg)
![Western Blot MYH7 Antibody (940906) [Unconjugated]](https://images.novusbio.com/images2/MYH7_MAB9096_Western_Blot_19525.jpg)
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ZNF133 Antibody [NBP1-80914] - Staining in human parathyroid gland and pancreas tissues using anti-ZNF133 antibody. Corresponding ZNF133 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ZNF133-Antibody-Immunohistochemistry-Paraffin-NBP1-80914-img0007.jpg "Immunohistochemistry-Paraffin: ZNF133 Antibody [NBP1-80914] - Staining in human parathyroid gland and pancreas tissues using anti-ZNF133 antibody. Corresponding ZNF133 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: ZNF133 Antibody [NBP1-80914] - Staining of human lateral ventricle shows strong nuclear positivity in neuronal cells.](http://images.novusbio.com/fullsize/ZNF133-Antibody-Immunohistochemistry-Paraffin-NBP1-80914-img0002.jpg "Immunohistochemistry-Paraffin: ZNF133 Antibody [NBP1-80914] - Staining of human lateral ventricle shows strong nuclear positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: ZNF133 Antibody [NBP1-80914] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/ZNF133-Antibody-Immunohistochemistry-Paraffin-NBP1-80914-img0005.jpg "Immunohistochemistry-Paraffin: ZNF133 Antibody [NBP1-80914] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: ZNF133 Antibody [NBP1-80914] - Staining of human parathyroid gland shows high expression.](http://images.novusbio.com/fullsize/ZNF133-Antibody-Immunohistochemistry-Paraffin-NBP1-80914-img0006.jpg "Immunohistochemistry-Paraffin: ZNF133 Antibody [NBP1-80914] - Staining of human parathyroid gland shows high expression.")
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![Simple Western 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/1433_zeta_MAB2669_Simple_Western_16526.jpg)
![Western Blot 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Western_Blot_12700.jpg)
![Immunohistochemistry 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Immunohistochemistry_12730.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")