ZMYM5 Antibody


Western Blot: ZMYM5 Antibody [NBP2-13551] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: ZMYM5 Antibody [NBP2-13551] - Staining of human kidney shows strong cytoplasmic and membranous positivity in distal tubules.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ZMYM5 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KEKTSQLQLSVECGTDTLLIQENVNLPPSSTSTIADTFQEQLEEKNFEDS IVPVVLSADPGTWPRILNIKQRDTLVENVP
Specificity of human ZMYM5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZMYM5 Protein (NBP2-13551PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ZMYM5 Antibody

  • zinc finger MYM-type protein 5
  • Zinc finger protein 198-like 1
  • Zinc finger protein 237HSPC050
  • zinc finger, MYM-type 5
  • ZNF198L1MYM
  • ZNF237


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ZMYM5 Antibody (NBP2-13551) (0)

There are no publications for ZMYM5 Antibody (NBP2-13551).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZMYM5 Antibody (NBP2-13551) (0)

There are no reviews for ZMYM5 Antibody (NBP2-13551). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZMYM5 Antibody (NBP2-13551) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZMYM5 Products

Bioinformatics Tool for ZMYM5 Antibody (NBP2-13551)

Discover related pathways, diseases and genes to ZMYM5 Antibody (NBP2-13551). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZMYM5 Antibody (NBP2-13551)

Discover more about diseases related to ZMYM5 Antibody (NBP2-13551).

PTMs for ZMYM5 Antibody (NBP2-13551)

Learn more about PTMs related to ZMYM5 Antibody (NBP2-13551).

Blogs on ZMYM5

There are no specific blogs for ZMYM5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZMYM5 Antibody and receive a gift card or discount.


Gene Symbol ZMYM5