ZMIZ2 Antibody - BSA Free

Western Blot: ZMIZ2 Antibody [NBP2-88639] - WB Suggested Anti-ZMIZ2 Antibody. Titration: 1.0 ug/ml. Positive Control: A549 Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ZMIZ2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZMIZ2 Antibody - BSA Free (NBP2-88639) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of ZMIZ2. Peptide sequence: HYKPTRSIPGYPSSPLPGNPTPPMTPSSSVPYMSPNQEVKSPFLPDLKPN The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZMIZ2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ZMIZ2 Antibody - BSA Free

• hZIMP7
• KIAA1886ZIMP7DKFZp761I2123
• NET27
• PIAS-like protein Zimp7
• TRAFIP20
• zinc finger MIZ domain-containing protein 2
• zinc finger, MIZ-type containing 2

Background

ZMIZ2 and ZMIZ1 (MIM 607159) are members of a PIAS (see MIM 603566)-like family of proteins that interact with nuclearhormone receptors. ZMIZ2 interacts with androgen receptor (AR; MIM 313700) and enhances AR-mediated transcription(Huang et al., 2005 (PubMed 16051670)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZMIZ2