ZKSCAN1 Antibody - BSA Free

Western Blot: ZKSCAN1 Antibody [NBP1-81346] - Analysis in human cell line SH-SY5Y.

Immunocytochemistry/Immunofluorescence: ZKSCAN1 Antibody [NBP1-81346] - Staining of human cell line A-431 shows localization to nucleus & nuclear bodies.

Immunohistochemistry-Paraffin: ZKSCAN1 Antibody [NBP1-81346] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.

ChIP-Exo-Seq composite graph for Anti-ZKSCAN1 (NBP1-81346) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZKSCAN1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZKSCAN1 Antibody - BSA Free (NBP1-81346) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NLARRNLSRDNRQENYGSAFPQGGENRNENEESTSKAETSEDSASRGETTGRSQKEFGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREKGKGLGRSFSLSSNFTTPEEVPTGTKSHRCDECGKCFTR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZKSCAN1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZKSCAN1 Protein (NBP1-81346PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZKSCAN1 Antibody - BSA Free

• KOX189130423L19Rik
• PHZ-37
• Zinc finger protein 139
• zinc finger protein 36 (KOX 18)
• Zinc finger protein 36
• Zinc finger protein KOX18
• zinc finger protein with KRAB and SCAN domains 1
• zinc finger with KRAB and SCAN domains 1
• ZNF139
• ZNF36MGC138429

Background

ZKSCAN1 is a zinc-finger protein that contains six C2H2-type zinc fingers, a SCAN box domain, and a KRAB (kruppel-associated box) domain. Due to its structure, the function of ZKSCAN1is predicted to be involved in transcription. The KRAB domain is found in many C2H2-type zinc fingers and may be involved in mediating protein-protein reactions. The SCAN domain (named after SRE-ZBP, CTfin51, AW-1, and Number 18 cDNA) may also be involved in protein interactions due to its ability to mediate homo- and hetero-oligomerization. Alternative names for ZKSCAN1 include zinc finger protein with KRAB and SCAN domains 1, KOX18, ZNF139, ZNF36, and PHZ-37.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZKSCAN1