![Western Blot: ZNF138 Antibody (4D11) [H00007697-M01] - Analysis of ZNF138 expression in transfected 293T cell line by ZNF138 monoclonal antibody (M01), clone 4D11.Lane 1: ZNF138 transfected lysate (Predicted MW: 30.7 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/ZNF138-Antibody-4D11-Western-Blot-H00007697-M01-img0004.jpg "Western Blot: ZNF138 Antibody (4D11) [H00007697-M01] - Analysis of ZNF138 expression in transfected 293T cell line by ZNF138 monoclonal antibody (M01), clone 4D11.Lane 1: ZNF138 transfected lysate (Predicted MW: 30.7 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 4D11 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | ZNF138 (NP_006515.1, 151 a.a. ~ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TNLSKPKKIHTGEKPYKCEVCGKAFHQSSILTKHKIIRTGEKPYKCAHCGKAFKQSSHLTRHKIIHTEEKPYKCEQCGKVFKQSPTLTKHQIIYTGEEPYK |
| Specificity | ZNF138 - zinc finger protein 138 (4D11) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ZNF138 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ZNF138 Antibody (4D11) [H00007697-M01] - Analysis of monoclonal antibody to ZNF138 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/ZNF138-Antibody-4D11-Immunohistochemistry-Paraffin-H00007697-M01-img0002.jpg "Immunohistochemistry-Paraffin: ZNF138 Antibody (4D11) [H00007697-M01] - Analysis of monoclonal antibody to ZNF138 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.")
![Sandwich ELISA: ZNF138 Antibody (4D11) [H00007697-M01] - Detection limit for recombinant GST tagged ZNF138 is 0.1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/ZNF138-Antibody-4D11-Sandwich-ELISA-H00007697-M01-img0003.jpg "Sandwich ELISA: ZNF138 Antibody (4D11) [H00007697-M01] - Detection limit for recombinant GST tagged ZNF138 is 0.1 ng/ml as a capture antibody.")
