CPI17 alpha Antibody

Images

 
Western Blot: CPI17 alpha Antibody [NBP2-37897] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line A-549
Orthogonal Strategies: Immunohistochemistry-Paraffin: CPI17 alpha Antibody [NBP2-37897] - Staining in human cerebral cortex and skin tissues using anti-PPP1R14A antibody. Corresponding PPP1R14A RNA-seq data are ...read more
Immunohistochemistry: CPI17 alpha Antibody [NBP2-37897] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferus ducts.
Immunohistochemistry-Paraffin: CPI17 alpha Antibody [NBP2-37897] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: CPI17 alpha Antibody [NBP2-37897] - Staining of human skin shows low expression as expected.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CPI17 alpha Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VKYDRRELQRRLDVEKWIDGRLEELYRGMEADMPDEINIDELLELESEEERSR
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP1R14A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CPI17 alpha Protein (NBP2-37897PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CPI17 alpha Antibody

  • 17 kDa PKC-potentiated inhibitory protein of PP1
  • CPI-1717-kDa PKC-potentiated inhibitory protein of PP1
  • CPI1717-KDa protein
  • PKC-potentiated inhibitory protein of PP1
  • PPP1INL
  • Protein kinase C-potentiated inhibitor protein of 17 kDa
  • protein phosphatase 1 regulatory subunit 14A
  • protein phosphatase 1, regulatory (inhibitor) subunit 14A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-38889
Species: Hu
Applications: IP, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-81555
Species: Hu
Applications: IHC, IHC-P, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NB100-624
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-62682
Species: Hu
Applications: IHC, IHC-P
NBP2-67486
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00085366-M01
Species: Hu, Mu
Applications: ELISA, KD, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-52452
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
QET00B
Species: Hu
Applications: ELISA
NBP2-37897
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IHC-P

Publications for CPI17 alpha Antibody (NBP2-37897) (0)

There are no publications for CPI17 alpha Antibody (NBP2-37897).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPI17 alpha Antibody (NBP2-37897) (0)

There are no reviews for CPI17 alpha Antibody (NBP2-37897). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPI17 alpha Antibody (NBP2-37897) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CPI17 alpha Products

Bioinformatics Tool for CPI17 alpha Antibody (NBP2-37897)

Discover related pathways, diseases and genes to CPI17 alpha Antibody (NBP2-37897). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPI17 alpha Antibody (NBP2-37897)

Discover more about diseases related to CPI17 alpha Antibody (NBP2-37897).
 

Pathways for CPI17 alpha Antibody (NBP2-37897)

View related products by pathway.

PTMs for CPI17 alpha Antibody (NBP2-37897)

Learn more about PTMs related to CPI17 alpha Antibody (NBP2-37897).
 

Research Areas for CPI17 alpha Antibody (NBP2-37897)

Find related products by research area.

Blogs on CPI17 alpha

There are no specific blogs for CPI17 alpha, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPI17 alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R14A
Uniprot