CPI17 alpha Antibody


Western Blot: CPI17 alpha Antibody [NBP2-37897] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line A-549
Orthogonal Strategies: Immunohistochemistry-Paraffin: CPI17 alpha Antibody [NBP2-37897] - Staining in human cerebral cortex and skin tissues using anti-PPP1R14A antibody. Corresponding PPP1R14A RNA-seq data are ...read more
Immunohistochemistry: CPI17 alpha Antibody [NBP2-37897] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferus ducts.
Immunohistochemistry-Paraffin: CPI17 alpha Antibody [NBP2-37897] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: CPI17 alpha Antibody [NBP2-37897] - Staining of human skin shows low expression as expected.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, Simple Western, IHC
Validated by:

Orthogonal Strategies


Order Details

CPI17 alpha Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: VKYDRRELQRRLDVEKWIDGRLEELYRGMEADMPDEINIDELLELESEEERSR
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western reported by internal validation
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western internal validation: Separated by size; matrix was 12-230 kDa; detected by Chemiluminescence.
Control Peptide
CPI17 alpha Protein (NBP2-37897PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CPI17 alpha Antibody

  • 17 kDa PKC-potentiated inhibitory protein of PP1
  • CPI-1717-kDa PKC-potentiated inhibitory protein of PP1
  • CPI1717-KDa protein
  • PKC-potentiated inhibitory protein of PP1
  • Protein kinase C-potentiated inhibitor protein of 17 kDa
  • protein phosphatase 1 regulatory subunit 14A
  • protein phosphatase 1, regulatory (inhibitor) subunit 14A


PKC Potentiated Inhibitor Protein-17 (CPI-17) is a 17 kDa protein (1). Expressed in smooth muscles and neuronal cells, CPI-17 is a myosin phosphatase inhibitor protein. Phosphorylation of CPI-17 at Thr38 enhances its inhibitory effect by 100 fold (2). Once phosphorylated, CPI-17 inhibits PP1c and MLCP holoenzyme activity (3).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CPI17 alpha Antibody (NBP2-37897) (0)

There are no publications for CPI17 alpha Antibody (NBP2-37897).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPI17 alpha Antibody (NBP2-37897) (0)

There are no reviews for CPI17 alpha Antibody (NBP2-37897). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPI17 alpha Antibody (NBP2-37897) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CPI17 alpha Products

Research Areas for CPI17 alpha Antibody (NBP2-37897)

Find related products by research area.

Blogs on CPI17 alpha

There are no specific blogs for CPI17 alpha, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CPI17 alpha Antibody and receive a gift card or discount.


Gene Symbol PPP1R14A