CPI17 alpha Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: VKYDRRELQRRLDVEKWIDGRLEELYRGMEADMPDEINIDELLELESEEERSR |
| Predicted Species |
Rat (92%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PPP1R14A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Simple Western
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. See Simple Western Antibody Database for Simple Western validation: Separated by size; matrix was 12-230 kDa; detected by Chemiluminescence. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CPI17 alpha Antibody - BSA Free
Background
PKC Potentiated Inhibitor Protein-17 (CPI-17) is a 17 kDa protein (1). Expressed in smooth muscles and neuronal cells, CPI-17 is a myosin phosphatase inhibitor protein. Phosphorylation of CPI-17 at Thr38 enhances its inhibitory effect by 100 fold (2). Once phosphorylated, CPI-17 inhibits PP1c and MLCP holoenzyme activity (3).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Ca, Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, KD, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Rt
Applications: WB, Simple Western, IHC
Publications for CPI17 alpha Antibody (NBP2-37897) (0)
There are no publications for CPI17 alpha Antibody (NBP2-37897).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CPI17 alpha Antibody (NBP2-37897) (0)
There are no reviews for CPI17 alpha Antibody (NBP2-37897).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CPI17 alpha Antibody (NBP2-37897) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CPI17 alpha Products
Research Areas for CPI17 alpha Antibody (NBP2-37897)
Find related products by research area.
|
Blogs on CPI17 alpha