CPI17 alpha Antibody - BSA Free

Western Blot: CPI17 alpha Antibody [NBP2-37897] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line A-549

Immunohistochemistry-Paraffin: CPI17 alpha Antibody [NBP2-37897] - Staining in human cerebral cortex and skin tissues using anti-PPP1R14A antibody. Corresponding PPP1R14A RNA-seq data are presented for the same tissues.

Immunohistochemistry: CPI17 alpha Antibody [NBP2-37897] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferus ducts.

Immunohistochemistry-Paraffin: CPI17 alpha Antibody [NBP2-37897] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: CPI17 alpha Antibody [NBP2-37897] - Staining of human skin shows low expression as expected.

• Reactivity: Hu, Rt
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CPI17 alpha Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CPI17 alpha Antibody - BSA Free (NBP2-37897) is a polyclonal antibody validated for use in IHC, WB and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VKYDRRELQRRLDVEKWIDGRLEELYRGMEADMPDEINIDELLELESEEERSR
• Predicted Species: Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP1R14A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. See Simple Western Antibody Database for Simple Western validation: Separated by size; matrix was 12-230 kDa; detected by Chemiluminescence.
• Control Peptide:

  CPI17 alpha Protein (NBP2-37897PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CPI17 alpha Antibody - BSA Free

• 17 kDa PKC-potentiated inhibitory protein of PP1
• CPI-1717-kDa PKC-potentiated inhibitory protein of PP1
• CPI1717-KDa protein
• PKC-potentiated inhibitory protein of PP1
• PPP1INL
• Protein kinase C-potentiated inhibitor protein of 17 kDa
• protein phosphatase 1 regulatory subunit 14A
• protein phosphatase 1, regulatory (inhibitor) subunit 14A

Background

PKC Potentiated Inhibitor Protein-17 (CPI-17) is a 17 kDa protein (1). Expressed in smooth muscles and neuronal cells, CPI-17 is a myosin phosphatase inhibitor protein. Phosphorylation of CPI-17 at Thr38 enhances its inhibitory effect by 100 fold (2). Once phosphorylated, CPI-17 inhibits PP1c and MLCP holoenzyme activity (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP1R14A
• Uniprot:
  • Q96A00(Human)