ZIC3 Antibody - BSA Free

Immunohistochemistry: ZIC3 Antibody [NBP2-33669] - Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in cells in granular layer.

ChIP-Exo-Seq composite graph for Anti-ZIC3 (NBP2-33669) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZIC3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZIC3 Antibody - BSA Free (NBP2-33669) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HEQGAGHPSPTGHVDNNQVHLGLRGELFGRADPYRPVA
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZIC3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ZIC3 Protein (NBP2-33669PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZIC3 Antibody - BSA Free

• Heterotaxy 1
• HTX1
• HTXHTX1
• Zic family member 3 (odd-paired homolog, Drosophila)
• ZIC3
• Zinc finger protein 203
• zinc finger protein ZIC 3
• ZNF203
• ZNF203Zinc finger protein of the cerebellum 3

Background

ZIC3 encodes a member of the ZIC family of C2H2-type zinc finger proteins. This nuclear protein probably functions as a transcription factor in early stages of left-right body axis formation. Mutations in this gene cause X-linked visceral heterotaxy, which includes congenital heart disease and left-right axis defects in organs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZIC3
• Uniprot:
  • O60481()