Zic2 Antibody (3C12)

Product Discontinued

Zic2 Antibody (3C12) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ZIC2 (NP_009060, 151 a.a. - 216 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDAQGHLLFPGLPEQHGPHGSQNVLNGQMRLGLPGEVFGRSEQYRQVASPRTDPY
• Specificity: ZIC2 - Zic family member 2 (odd-paired homolog, Drosophila) (3C12)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ZIC2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Zic2 Antibody (3C12)

• HPE5Zic family member 2 (odd-paired Drosophila homolog)
• Zic family member 2 (odd-paired homolog, Drosophila)
• Zinc finger protein of the cerebellum 2
• zinc finger protein ZIC 2

Background

This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. This protein functions as a transcriptional repressor and may regulate tissue specific expression of dopamine receptor D1. Mutations in this gene cause holoprosencephaly type 5. Holoprosencephaly is the most common structural anomaly of the human brain. A polyhistidine tract polymorphism in this gene may be associated with increased risk of neural tube defects. This gene is closely linked to a gene encoding zinc finger protein of the cerebellum 5, a related family member on chromosome 13. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZIC2
• Entrez:
  • 7546(Human)
• Uniprot:
  • NP_009060(Human)