ZHX3 Antibody (1D9) - Azide and BSA Free

Immunohistochemistry-Paraffin: ZHX3 Antibody (1D9) [H00023051-M03] - Analysis of monoclonal antibody to ZHX3 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml

Sandwich ELISA: ZHX3 Antibody (1D9) [H00023051-M03] - Detection limit for recombinant GST tagged ZHX3 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 1D9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZHX3 Antibody (1D9) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ZHX3 Antibody (1D9) - Azide and BSA Free (H00023051-M03) is a monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ZHX3 (NP_055850.1, 863 a.a. ~ 955 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EDLQNLCDKTQMSSQQVKQWFAEKMGEETRAVADTGSEDQGPGTGELTAVHKGMGDTYSEVSENSESWEPRVPEASSEPFDTSSPQAGRQLET
• Specificity: ZHX3 - zinc fingers and homeoboxes 3 (1D9)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ZHX3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZHX3 Antibody (1D9) - Azide and BSA Free

• FLJ93221
• SP38
• zona pellucida binding protein
• zona pellucida-binding protein 1
• ZPBP1zona pellucida binding protein 1

Background

This gene encodes a member of the zinc fingers and homeoboxes (ZHX) gene family. The encoded protein contains two C2H2-type zinc fingers and five homeodomains and forms a dimer with itself or with zinc fingers and homeoboxes family member 1. In the nucleus, the dimerized protein interacts with the A subunit of the ubiquitous transcription factor nuclear factor-Y and may function as a transcriptional repressor. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZHX3
• Entrez:
  • 23051(Human)
• Uniprot:
  • NP_055850(Human)