Zhangfei Antibody

Immunocytochemistry/Immunofluorescence: Zhangfei Antibody [NBP2-57754] - Staining of human cell line HeLa shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.

Product Discontinued

Zhangfei Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSL
• Predicted Species: Mouse (90%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CREBZF
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Zhangfei Antibody

• CREB/ATF bZIP transcription factor
• FLJ94018
• HCF-binding transcription factor Zhangfei
• Host cell factor-binding transcription factor Zhangfei
• SHP-interacting leucine zipper protein
• SMILE
• Zhangfei

Background

Strongly activates transcription when bound to HCFC1. Suppresses the expression of HSV proteins in cellsinfected with the virus in a HCFC1-dependent manner. Also suppresses the HCFC1-dependent transcriptional activation byCREB3 and reduces the amount of CREB3 in the cell. Able to down-regulate expression of some cellular genes inCREBZF-expressing cells

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CREBZF