ZGPAT Antibody

Images

 
Western Blot: ZGPAT Antibody [NBP2-55609] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/ Immunofluorescence: ZGPAT Antibody [NBP2-55609] - Staining of human cell line CACO-2 shows localization to nucleus & plasma membrane.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZGPAT Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALCPSLAVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGKGLGRHAEGRVEPIHAVVLPRGKSLDQCVETLQKQTRVG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZGPAT
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZGPAT Recombinant Protein Antigen (NBP2-55609PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ZGPAT Antibody

  • GPATC6G patch domain-containing protein 6
  • GPATCH6Zinc finger and G patch domain-containing protein
  • KIAA1847Zinc finger CCCH domain-containing protein 9
  • MGC44880
  • ZC3H9FLJ14972
  • ZC3HDC9dJ583P15.3
  • zinc finger, CCCH-type with G patch domain
  • ZIPzinc finger CCCH-type with G patch domain-containing protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76498
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-76962
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC
NBP1-59357
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76499
Species: Hu, Mu, Rt, Eq
Applications: WB, ELISA, ICC/IF, IHC
NBP1-86829
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7315
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-76505
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86825
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76510
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76504
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-46063
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
NBP2-55609
Species: Hu
Applications: WB, ICC/IF

Publications for ZGPAT Antibody (NBP2-55609) (0)

There are no publications for ZGPAT Antibody (NBP2-55609).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZGPAT Antibody (NBP2-55609) (0)

There are no reviews for ZGPAT Antibody (NBP2-55609). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZGPAT Antibody (NBP2-55609) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZGPAT Products

Bioinformatics Tool for ZGPAT Antibody (NBP2-55609)

Discover related pathways, diseases and genes to ZGPAT Antibody (NBP2-55609). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZGPAT Antibody (NBP2-55609)

Discover more about diseases related to ZGPAT Antibody (NBP2-55609).
 

Pathways for ZGPAT Antibody (NBP2-55609)

View related products by pathway.

PTMs for ZGPAT Antibody (NBP2-55609)

Learn more about PTMs related to ZGPAT Antibody (NBP2-55609).

Blogs on ZGPAT

There are no specific blogs for ZGPAT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZGPAT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZGPAT