ZGPAT Antibody


Western Blot: ZGPAT Antibody [NBP2-55609] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/ Immunofluorescence: ZGPAT Antibody [NBP2-55609] - Staining of human cell line CACO-2 shows localization to nucleus & plasma membrane.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF

Order Details

ZGPAT Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ALCPSLAVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGKGLGRHAEGRVEPIHAVVLPRGKSLDQCVETLQKQTRVG
Specificity of human ZGPAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZGPAT Recombinant Protein Antigen (NBP2-55609PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for ZGPAT Antibody

  • GPATC6G patch domain-containing protein 6
  • GPATCH6Zinc finger and G patch domain-containing protein
  • KIAA1847Zinc finger CCCH domain-containing protein 9
  • MGC44880
  • ZC3H9FLJ14972
  • ZC3HDC9dJ583P15.3
  • zinc finger, CCCH-type with G patch domain
  • ZIPzinc finger CCCH-type with G patch domain-containing protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC, IF
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu, Mu, Rt, Eq
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP

Publications for ZGPAT Antibody (NBP2-55609) (0)

There are no publications for ZGPAT Antibody (NBP2-55609).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZGPAT Antibody (NBP2-55609) (0)

There are no reviews for ZGPAT Antibody (NBP2-55609). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZGPAT Antibody (NBP2-55609) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ZGPAT Antibody (NBP2-55609)

Discover related pathways, diseases and genes to ZGPAT Antibody (NBP2-55609). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZGPAT Antibody (NBP2-55609)

Discover more about diseases related to ZGPAT Antibody (NBP2-55609).

Pathways for ZGPAT Antibody (NBP2-55609)

View related products by pathway.

PTMs for ZGPAT Antibody (NBP2-55609)

Learn more about PTMs related to ZGPAT Antibody (NBP2-55609).

Blogs on ZGPAT

There are no specific blogs for ZGPAT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZGPAT Antibody and receive a gift card or discount.


Gene Symbol ZGPAT