ZGLP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZGLP1 Antibody [NBP2-13548] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: ZGLP1 Antibody [NBP2-13548] - Staining of human heart muscle shows moderate nuclear membrane positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZGLP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLDRDSKDTQTRISQKGRRLQPPGTPSAPPQRRPRKQLNPCRGTERVDPG FEGVTLKFQIKPDSSLQIIPTYSLPCSSRSQE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZGLP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZGLP1 Protein (NBP2-13548PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZGLP1 Antibody

  • GATA-type zinc finger protein 1
  • GLP1
  • GLP-1
  • zinc finger, GATA-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB8864
Species: Hu
Applications: IHC
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-89771
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3145
Species: Hu
Applications: WB
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-80865
Species: Hu
Applications: IHC, IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
MAB8200
Species: Hu, Mu
Applications: IHC
PP-B0422-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
NB100-2436
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-20116
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, DB, ICC/IF, IHC, IHC-P
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-13548
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZGLP1 Antibody (NBP2-13548) (0)

There are no publications for ZGLP1 Antibody (NBP2-13548).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZGLP1 Antibody (NBP2-13548) (0)

There are no reviews for ZGLP1 Antibody (NBP2-13548). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZGLP1 Antibody (NBP2-13548) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZGLP1 Products

Bioinformatics Tool for ZGLP1 Antibody (NBP2-13548)

Discover related pathways, diseases and genes to ZGLP1 Antibody (NBP2-13548). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZGLP1

There are no specific blogs for ZGLP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZGLP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZGLP1