Recombinant Human ZFYVE16 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZFYVE16 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human ZFYVE16 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDSYFKAAVSDLDKLLDDFEQNPDEQDYLQDVQNAYDSNHCSVSSELASSQRTSLLPKDQECVNSCASSETSYGTNESSLNEKTLKGLTSIQNEKNVTGL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZFYVE16

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZFYVE16 Protein

  • DKFZp686E13162
  • ENDOFIN
  • endosome-associated FYVE-domain protein
  • KIAA0305Endosome-associated FYVE domain protein
  • zinc finger FYVE domain-containing protein 16
  • zinc finger, FYVE domain containing 16

Background

ZFYVE16 - zinc finger, FYVE domain containing 16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57521
Species: Hu
Applications: ICC/IF
NBP1-80789
Species: Hu
Applications: WB, IHC, IHC-P
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF3025
Species: Hu
Applications: WB, ICC
NBP2-45808
Species: Hu
Applications: IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
MAB2029
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-86170
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for ZFYVE16 Partial Recombinant Protein (H00009765-Q01) (0)

There are no publications for ZFYVE16 Partial Recombinant Protein (H00009765-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFYVE16 Partial Recombinant Protein (H00009765-Q01) (0)

There are no reviews for ZFYVE16 Partial Recombinant Protein (H00009765-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZFYVE16 Partial Recombinant Protein (H00009765-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZFYVE16 Products

Bioinformatics Tool for ZFYVE16 Partial Recombinant Protein (H00009765-Q01)

Discover related pathways, diseases and genes to ZFYVE16 Partial Recombinant Protein (H00009765-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFYVE16 Partial Recombinant Protein (H00009765-Q01)

Discover more about diseases related to ZFYVE16 Partial Recombinant Protein (H00009765-Q01).
 

Pathways for ZFYVE16 Partial Recombinant Protein (H00009765-Q01)

View related products by pathway.

PTMs for ZFYVE16 Partial Recombinant Protein (H00009765-Q01)

Learn more about PTMs related to ZFYVE16 Partial Recombinant Protein (H00009765-Q01).

Blogs on ZFYVE16

There are no specific blogs for ZFYVE16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZFYVE16 Antibody
NBP1-81516

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZFYVE16 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFYVE16