ZFP90 Antibody - BSA Free

Western Blot: ZFP90 Antibody [NBP1-79411] - SH-SYSY cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ZFP90 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human ZFP90The immunogen for this antibody is ZFP90. Peptide sequence SSLVQHQRIHTGEKPYRCNLCGRSFRHGTSLTQHEVTHSGEKPFQCKECG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZFP90
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ZFP90 Antibody - BSA Free

• FoxP3-interacting Protein
• KIAA1954
• NK10
• ZFP90
• zfp-90
• zinc finger protein 476
• zinc finger protein 756
• zinc finger protein 90 homolog (mouse)
• zinc finger protein 90 homolog
• ZNF756

Background

ZFP90 may function as a repressor or silencer protein, and most likely exerts its repressing activity uponzinc-dependent binding to DNA. May be involved in proper spermatogenesis byrepressing the expression of genesunnecessary or incompatible with the maintena

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZFP90
• Uniprot:
  • NP_597715(Human)