ZDHHC7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZDHHC7 Antibody [NBP2-56799] - Staining of human cell line PC-3 shows localization to the Golgi apparatus.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZDHHC7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LKSENPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFS
Specificity
Specificity of human ZDHHC7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZDHHC7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ZDHHC7 Antibody

  • EC 2.3.1
  • EC 2.3.1.-
  • FLJ10792
  • FLJ20279
  • palmitoyltransferase ZDHHC7
  • Sertoli cell gene with zinc finger domain- and #946
  • SERZ1
  • SERZ-B
  • Zinc finger DHHC domain-containing protein 7
  • Zinc finger protein 370
  • zinc finger, DHHC domain containing 7
  • zinc finger, DHHC-type containing 7
  • ZNF370DHHC-7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-57201
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-645
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-58901
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Sh
Applications: WB
H00005555-P01
Species: Hu
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-53144
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB, IHC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NBP1-32728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00134391-B01P
Species: Hu
Applications: WB, ELISA, Flow
NBP1-85057
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-76869
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC
NBP2-13541
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-56799
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for ZDHHC7 Antibody (NBP2-56799) (0)

There are no publications for ZDHHC7 Antibody (NBP2-56799).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDHHC7 Antibody (NBP2-56799) (0)

There are no reviews for ZDHHC7 Antibody (NBP2-56799). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZDHHC7 Antibody (NBP2-56799) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZDHHC7 Products

Bioinformatics Tool for ZDHHC7 Antibody (NBP2-56799)

Discover related pathways, diseases and genes to ZDHHC7 Antibody (NBP2-56799). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZDHHC7 Antibody (NBP2-56799)

Discover more about diseases related to ZDHHC7 Antibody (NBP2-56799).
 

Pathways for ZDHHC7 Antibody (NBP2-56799)

View related products by pathway.

PTMs for ZDHHC7 Antibody (NBP2-56799)

Learn more about PTMs related to ZDHHC7 Antibody (NBP2-56799).

Blogs on ZDHHC7

There are no specific blogs for ZDHHC7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZDHHC7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZDHHC7