| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: KEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRCQLI |
| Predicted Species | Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZDHHC2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. See Simple Western Antibody Database for Simple Western validation: Tested in Liver, separated by Size, antibody dilution of 1:20, apparent MW was 50 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-13541 | Applications | Species |
|---|---|---|
| Brichta L, Shin W, Jackson-Lewis V et al. Identification of neurodegenerative factors using translatome-regulatory network analysis Nat. Neurosci. 2015-07-27 [PMID: 26214373] (IF/IHC, WB, Human, Mouse) | IF/IHC, WB | Human, Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for ZDHHC2 Antibody (NBP2-13541)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZDHHC2 |