ZBTB20 Antibody (1F3) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: ZBTB20 Antibody (1F3) [H00026137-M01] - Analysis of monoclonal antibody to ZBTB20 on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: ZBTB20 Antibody (1F3) [H00026137-M01] - Detection limit for recombinant GST tagged ZBTB20 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 1F3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZBTB20 Antibody (1F3) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ZBTB20 Antibody (1F3) - Azide and BSA Free (H00026137-M01) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ZBTB20 (NP_056457, 451 a.a. ~ 542 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FLFSLPQPLAGQQTQFVTVSQPGLSTFTAQLPAPQPLASSAGHSTASGQGEKKPYECTLCNKTFTAKQNYVKHMFVHTGEKPHQCSICWRSF
• Specificity: This product is specific for Human ZBTB20 monoclonal antibody (M01), clone 1F3 [Gene ID: 26137].
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ZBTB20
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot
• Application Notes: Mouse monoclonal antibody raised against a partial recombinant ZBTB20.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZBTB20 Antibody (1F3) - Azide and BSA Free

• BTB/POZ zinc finger protein DPZF
• dendritic cell-derived BTB/POZ zinc finger
• Dendritic-derived BTB/POZ zinc finger protein
• DPZFZinc finger protein 288ZNF288DKFZp566F123
• FLJ26458
• HOF
• ODA-8S
• zinc finger and BTB domain containing 20
• zinc finger and BTB domain-containing protein 20

Background

ZBTB20 - zinc finger and BTB domain containing 20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZBTB20
• Uniprot:
  • NP_056457(Human)