Recombinant Human ZBP1/DLM-1/DAI Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ZBP1/DLM-1/DAI Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2-100 of Human ZBP1/DLM-1/DAI

Source: Wheat Germ

Amino Acid Sequence: AQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAKRPQQHAATIPET

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZBP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZBP1/DLM-1/DAI Protein

  • C20orf183
  • chromosome 20 open reading frame 183
  • DAI
  • DLM1
  • DLM-1
  • DLM1dJ718J7.3
  • DNA-dependent activator of interferon regulatory factors
  • DNA-dependent activator of IRFs
  • Tumor stroma and activated macrophage protein DLM-1
  • ZBP1 Z-DNA binding protein 1
  • ZBP1
  • Z-DNA binding protein 1
  • Z-DNA-binding protein 1

Background

DLM1 encodes a Z-DNA binding protein. Z-DNA formation is a dynamic process, largely controlled by the amount of supercoiling.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PP-H7431-00
Species: Hu
Applications: WB
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Mk, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP2-38956
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
H00009447-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-66402
Species: Hu
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-27419
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-77299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-32276
Species: Hu
Applications: WB, IP

Publications for ZBP1/DLM-1/DAI Partial Recombinant Protein (H00081030-Q01) (0)

There are no publications for ZBP1/DLM-1/DAI Partial Recombinant Protein (H00081030-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZBP1/DLM-1/DAI Partial Recombinant Protein (H00081030-Q01) (0)

There are no reviews for ZBP1/DLM-1/DAI Partial Recombinant Protein (H00081030-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZBP1/DLM-1/DAI Partial Recombinant Protein (H00081030-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZBP1/DLM-1/DAI Products

Bioinformatics Tool for ZBP1/DLM-1/DAI Partial Recombinant Protein (H00081030-Q01)

Discover related pathways, diseases and genes to ZBP1/DLM-1/DAI Partial Recombinant Protein (H00081030-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZBP1/DLM-1/DAI Partial Recombinant Protein (H00081030-Q01)

Discover more about diseases related to ZBP1/DLM-1/DAI Partial Recombinant Protein (H00081030-Q01).
 

Pathways for ZBP1/DLM-1/DAI Partial Recombinant Protein (H00081030-Q01)

View related products by pathway.

PTMs for ZBP1/DLM-1/DAI Partial Recombinant Protein (H00081030-Q01)

Learn more about PTMs related to ZBP1/DLM-1/DAI Partial Recombinant Protein (H00081030-Q01).

Blogs on ZBP1/DLM-1/DAI

There are no specific blogs for ZBP1/DLM-1/DAI, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZBP1/DLM-1/DAI Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBP1
Entrez