YTHDF2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: YTHDF2 Antibody [NBP2-58340] - Staining of human cell line HeLa shows localization to cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

YTHDF2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNY
Specificity
Specificity of human YTHDF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
YTHDF2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
YTHDF2 Recombinant Protein Antigen (NBP2-58340PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for YTHDF2 Antibody

  • CLL-associated antigen KW-14
  • HGRG8YTH domain family 2
  • High-glucose-regulated protein 8
  • NY-REN-2,9430020E02Rik
  • Renal carcinoma antigen NY-REN-2
  • YTH domain family protein 2
  • YTH domain family, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1005
Species: Hu
Applications: WB, IHC
NBP2-24737
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-85699
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00117581-M01
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-80726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38346
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55947
Species: Hu
Applications: ICC/IF
NBP1-76876
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49541
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
NBP1-36979
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-41128
Species: Hu
Applications: ELISA, IHC, IHC-P
H00006883-M11
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-81914
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-14889
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P

Publications for YTHDF2 Antibody (NBP2-58340) (0)

There are no publications for YTHDF2 Antibody (NBP2-58340).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YTHDF2 Antibody (NBP2-58340) (0)

There are no reviews for YTHDF2 Antibody (NBP2-58340). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for YTHDF2 Antibody (NBP2-58340) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional YTHDF2 Products

Bioinformatics Tool for YTHDF2 Antibody (NBP2-58340)

Discover related pathways, diseases and genes to YTHDF2 Antibody (NBP2-58340). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for YTHDF2 Antibody (NBP2-58340)

Discover more about diseases related to YTHDF2 Antibody (NBP2-58340).
 

Pathways for YTHDF2 Antibody (NBP2-58340)

View related products by pathway.

Blogs on YTHDF2

There are no specific blogs for YTHDF2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our YTHDF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol YTHDF2