SLITRK5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLITRK5 Antibody [NBP1-90798] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemistry-Paraffin: SLITRK5 Antibody [NBP1-90798] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cell and glial cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLITRK5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LKSLIQIDLHDNPWDCTCDIVGMKLWVEQLKVGVLVDEVICKAPKKFAETDMRSIKSELLCPDYSDVVVSTPTPSSIQVPARTSAVTPAVRLNSTGAPASLGAGGGASSVPL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLITRK5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLITRK5 Protein (NBP1-90798PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLITRK5 Antibody

  • bA364G4.2
  • FLJ58374
  • KIAA0918
  • leucine-rich repeat-containing protein 11
  • LRRC11
  • SLIT and NTRK-like family, member 5
  • SLIT and NTRK-like protein 5
  • SLITRK5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76877
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-49541
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
AF2657
Species: Hu
Applications: WB
NBP2-56537
Species: Hu
Applications: ICC/IF
8957-SK
Species: Hu
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-80726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47373
Species: Hu
Applications: IHC, IHC-P
NBP2-55947
Species: Hu
Applications: ICC/IF
NBP1-76878
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF1005
Species: Hu
Applications: WB, IHC
NBP2-31785
Species: Hu
Applications: IHC, IHC-P
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-24737
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00117581-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-32730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90798
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for SLITRK5 Antibody (NBP1-90798) (0)

There are no publications for SLITRK5 Antibody (NBP1-90798).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLITRK5 Antibody (NBP1-90798) (0)

There are no reviews for SLITRK5 Antibody (NBP1-90798). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLITRK5 Antibody (NBP1-90798) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLITRK5 Products

Bioinformatics Tool for SLITRK5 Antibody (NBP1-90798)

Discover related pathways, diseases and genes to SLITRK5 Antibody (NBP1-90798). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLITRK5 Antibody (NBP1-90798)

Discover more about diseases related to SLITRK5 Antibody (NBP1-90798).
 

Pathways for SLITRK5 Antibody (NBP1-90798)

View related products by pathway.

Blogs on SLITRK5

There are no specific blogs for SLITRK5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLITRK5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLITRK5
Entrez