YF5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: YF5 Antibody [NBP1-89338] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: YF5 Antibody [NBP1-89338] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

YF5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KLCCTLSSLSSAAETGRDPLDSEEEATSGAQDERGLKPPSRGQFPSLSARDASSSHRGRNVLTAILLLLRELDAEGLEAVQQTVGSR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C21ORF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
YF5 Protein (NBP1-89338PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for YF5 Antibody

  • A2
  • C21orf2
  • C21orf-HUMF09G8.5
  • chromosome 21 open reading frame 2
  • hypothetical protein LOC755
  • nuclear encoded mitochondrial protein, cDNA A2-YF5, 10
  • YF5
  • YF5/A2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00064699-M01
Species: Hu
Applications: WB, ELISA
NBP1-87842
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
MAB6184
Species: Mu
Applications: WB, CyTOF-ready, ICFlow
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NB100-61071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90240
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for YF5 Antibody (NBP1-89338) (0)

There are no publications for YF5 Antibody (NBP1-89338).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YF5 Antibody (NBP1-89338) (0)

There are no reviews for YF5 Antibody (NBP1-89338). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for YF5 Antibody (NBP1-89338) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional YF5 Products

Bioinformatics Tool for YF5 Antibody (NBP1-89338)

Discover related pathways, diseases and genes to YF5 Antibody (NBP1-89338). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for YF5 Antibody (NBP1-89338)

Discover more about diseases related to YF5 Antibody (NBP1-89338).
 

Pathways for YF5 Antibody (NBP1-89338)

View related products by pathway.

Blogs on YF5

There are no specific blogs for YF5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our YF5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C21ORF2