YARS Antibody

Images

 
Western Blot: YARS Antibody [NBP1-86890] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: YARS Antibody [NBP1-86890] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear bodies & cytosol.
Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86890] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
Western Blot: YARS Antibody [NBP1-86890] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

YARS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSIS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
YARS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
YARS Protein (NBP1-86890PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for YARS Antibody

  • CMTDIC
  • EC 6.1.1
  • EC 6.1.1.1
  • Tyrosyl--tRNA ligase
  • tyrosyl-tRNA synthetase
  • tyrosyl-tRNA synthetase, cytoplasmic
  • TYRRS
  • YRStyrRS
  • YTStyrosine tRNA ligase 1, cytoplasmic

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-54653
Species: Hu
Applications: WB
NBP2-20744
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92106
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
NBP2-07799
Species: Hu
NBP1-89487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87698
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-85937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00006301-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86890
Species: Hu, Mu, Rt, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for YARS Antibody (NBP1-86890) (0)

There are no publications for YARS Antibody (NBP1-86890).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YARS Antibody (NBP1-86890) (0)

There are no reviews for YARS Antibody (NBP1-86890). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for YARS Antibody (NBP1-86890) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our YARS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol YARS