xylosyltransferase 1 Antibody

Images

 
Immunohistochemistry: xylosyltransferase 1 Antibody [NBP1-90675] - Staining of human skeletal muscle shows moderate cytoplasmic positivity.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

xylosyltransferase 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VWTVKILHHWVPVAETKFLVAPLTFSNRQPIKPEEALKLHNGPLRNAYMEQSFQSLNPVLSLPINPAQVEQARRNAASTGTALEGWLDSLVGGMWTAMDICATGPTACPVMQTCSQTAWSSFSPDPKSELG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
XYLT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
xylosyltransferase 1 Protein (NBP1-90675PEP)
Publications
Read Publication using NBP1-90675.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22146554)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for xylosyltransferase 1 Antibody

  • beta-D-xylosyltransferase 1
  • O-xylosyltransferase 1
  • peptide O-xylosyltransferase 1
  • PXYLT1
  • XT1
  • xylosyltransferase 1
  • xylosyltransferase I
  • xylT-I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33208
Species: Hu
Applications: WB, ICC/IF
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
H00000259-D01P
Species: Hu, Mu, Rt
Applications: WB
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF2667
Species: Hu
Applications: WB, IHC
NBP1-42342
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-88662
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2536
Species: Mu
Applications: WB
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA

Publications for xylosyltransferase 1 Antibody (NBP1-90675)(1)

Reviews for xylosyltransferase 1 Antibody (NBP1-90675) (0)

There are no reviews for xylosyltransferase 1 Antibody (NBP1-90675). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for xylosyltransferase 1 Antibody (NBP1-90675) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional xylosyltransferase 1 Products

Bioinformatics Tool for xylosyltransferase 1 Antibody (NBP1-90675)

Discover related pathways, diseases and genes to xylosyltransferase 1 Antibody (NBP1-90675). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for xylosyltransferase 1 Antibody (NBP1-90675)

Discover more about diseases related to xylosyltransferase 1 Antibody (NBP1-90675).
 

Pathways for xylosyltransferase 1 Antibody (NBP1-90675)

View related products by pathway.

Blogs on xylosyltransferase 1

There are no specific blogs for xylosyltransferase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our xylosyltransferase 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol XYLT1