XTP3TPA Antibody

Images

 
Western Blot: XTP3TPA Antibody [NBP1-85736] - Analysis in control (vector only transfected HEK293T lysate) and DCTPP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: XTP3TPA Antibody [NBP1-85736] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: XTP3TPA Antibody [NBP1-85736] - Staining of human corpus, uterine shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

XTP3TPA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDS
Specificity
Specificity of human XTP3TPA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCTPP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
IHC reported in scientific literature (PMID: 25379943). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Publications
Read Publications using
NBP1-85736 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%). Human reactivity reported in scientific literature (PMID: 25379943).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for XTP3TPA Antibody

  • dCTP pyrophosphatase 1
  • dCTPase 1
  • Deoxycytidine-triphosphatase 1
  • EC 3.6.1.12
  • MGC5627
  • RS21C6XTP3-transactivated gene A protein
  • XTP3TPACDA03
  • XTP3-transactivated protein A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
NBP1-77397
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, KD
NBP2-67822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
NB120-2765
Species: Hu, Mu, Rt, Bv, Ch, Gp, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-89113
Species: Hu, Mu, Rt
Applications: ICC/IF (-), WB, ICC/IF, IHC, IHC-P
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
H00005555-P01
Species: Hu
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-76846
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02042
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85736
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for XTP3TPA Antibody (NBP1-85736)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for XTP3TPA Antibody (NBP1-85736) (0)

There are no reviews for XTP3TPA Antibody (NBP1-85736). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for XTP3TPA Antibody (NBP1-85736) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional XTP3TPA Products

Bioinformatics Tool for XTP3TPA Antibody (NBP1-85736)

Discover related pathways, diseases and genes to XTP3TPA Antibody (NBP1-85736). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XTP3TPA Antibody (NBP1-85736)

Discover more about diseases related to XTP3TPA Antibody (NBP1-85736).

PTMs for XTP3TPA Antibody (NBP1-85736)

Learn more about PTMs related to XTP3TPA Antibody (NBP1-85736).

Blogs on XTP3TPA

There are no specific blogs for XTP3TPA, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XTP3TPA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DCTPP1
COVID-19 update